Gene/Proteome Database (LMPD)
LMPD ID
LMP000545
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Synonyms
GPI2
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit C; PIG-C; phosphatidylinositol-glycan biosynthesis class C protein; phosphatidylinositol-glycan biosynthesis, class C protein
Chromosome
1
Map Location
1q23-q25
EC Number
2.4.1.198
Summary
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. Two alternatively spliced transcripts that encode the same protein have been found for this gene. A pseudogene on chromosome 11 has also been characterized. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| phosphatidylinositol N-acetylglucosaminyltransferase subunit C | |
|---|---|
| Refseq ID | NP_714969 |
| Protein GI | 24430186 |
| UniProt ID | Q92535 |
| mRNA ID | NM_153747 |
| Length | 297 |
| RefSeq Status | REVIEWED |
| MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0000506 | IDA:MGI | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003824 | TAS:ProtInc | F | catalytic activity |
| GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006501 | TAS:Reactome | P | C-terminal protein lipidation |
| GO:0006506 | TAS:ProtInc | P | GPI anchor biosynthetic process |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0016254 | TAS:Reactome | P | preassembly of GPI anchor in ER membrane |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| hsa01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_952 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009450 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit C |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Protein Entry
PIGC_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the PIGC family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
| Subunit | Associates with PIGA, PIGH, PIGP, PIGQ and DPM2. The latter is not essential for activity. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Phosphatidylinositol N-acetylglucosaminyltransferase subunit C8; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_556"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000545 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 24430186 | RefSeq | NP_714969 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C |
Identical Sequences to LMP000545 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24430186 | EMBL | CAG29288.1 | 297 | PIGC, partial [Homo sapiens] |
| GI:24430186 | GenBank | AAX42111.1 | 297 | phosphatidylinositol glycan class C [synthetic construct] |
| GI:24430186 | GenBank | AAX42112.1 | 297 | phosphatidylinositol glycan class C [synthetic construct] |
| GI:24430186 | GenBank | AHD79544.1 | 297 | Sequence 29188 from patent US 8586006 |
| GI:24430186 | GenBank | AHD79545.1 | 297 | Sequence 29189 from patent US 8586006 |
| GI:24430186 | RefSeq | XP_006711446.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Homo sapiens] |
Related Sequences to LMP000545 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:24430186 | GenBank | AAP36641.1 | 298 | Homo sapiens phosphatidylinositol glycan, class C, partial [synthetic construct] |
| GI:24430186 | GenBank | AAX29574.1 | 298 | phosphatidylinositol glycan class C, partial [synthetic construct] |
| GI:24430186 | GenBank | AAX29575.1 | 298 | phosphatidylinositol glycan class C, partial [synthetic construct] |
| GI:24430186 | GenBank | EAW90926.1 | 297 | phosphatidylinositol glycan, class C, isoform CRA_a [Homo sapiens] |
| GI:24430186 | GenBank | EAW90927.1 | 297 | phosphatidylinositol glycan, class C, isoform CRA_a [Homo sapiens] |
| GI:24430186 | GenBank | AIC54900.1 | 297 | PIGC, partial [synthetic construct] |