Gene/Proteome Database (LMPD)

LMPD ID
LMP000549
Gene ID
12389
Species
Mus musculus (Mouse)
Gene Name
caveolin 1, caveolae protein
Gene Symbol
Cav1
Synonyms
Cav; Cav-1
Alternate Names
caveolin-1; caveolin, caveolae protein 1; caveolin, caveolae protein, 22 kDa
Chromosome
6
Map Location
6|6 A2

Proteins

caveolin-1 isoform 1
Refseq ID NP_031642
Protein GI 6680854
UniProt ID P49817
mRNA ID NM_007616
Length 178
RefSeq Status VALIDATED
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
caveolin-1 isoform 2
Refseq ID NP_001229993
Protein GI 340139110
UniProt ID P49817
mRNA ID NM_001243064
Length 147
RefSeq Status VALIDATED
MADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI

Gene Information

Entrez Gene ID
12389
Gene Name
caveolin 1, caveolae protein
Gene Symbol
Cav1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:MGI C Golgi apparatus
GO:0000139 ISS:HGNC C Golgi membrane
GO:0002080 IDA:MGI C acrosomal membrane
GO:0016324 IEA:Ensembl C apical plasma membrane
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0005901 ISS:UniProtKB C caveola
GO:0005938 IDA:MGI C cell cortex
GO:0005929 IDA:MGI C cilium
GO:0031410 ISO:MGI C cytoplasmic vesicle
GO:0005783 ISS:HGNC C endoplasmic reticulum
GO:0005768 ISS:UniProtKB C endosome
GO:0016021 IDA:MGI C integral component of membrane
GO:0005887 IDA:MGI C integral component of plasma membrane
GO:0016020 IDA:MGI C membrane
GO:0045121 IDA:MGI C membrane raft
GO:0048471 IDA:MGI C perinuclear region of cytoplasm
GO:0005886 IDA:MGI C plasma membrane
GO:0043234 IPI:MGI C protein complex
GO:0016504 IMP:MGI F peptidase activator activity
GO:0005198 IEA:Ensembl F structural molecule activity
GO:0000165 IMP:MGI P MAPK cascade
GO:0031295 ISS:UniProtKB P T cell costimulation
GO:0001525 IGI:MGI P angiogenesis
GO:0097190 IEA:Ensembl P apoptotic signaling pathway
GO:0055074 IMP:MGI P calcium ion homeostasis
GO:0006816 IMP:MGI P calcium ion transport
GO:0070836 IMP:MGI P caveola assembly
GO:0072584 IEA:Ensembl P caveolin-mediated endocytosis
GO:0006874 IMP:MGI P cellular calcium ion homeostasis
GO:0071455 IEA:Ensembl P cellular response to hyperoxia
GO:0009267 IEA:Ensembl P cellular response to starvation
GO:0042632 IMP:MGI P cholesterol homeostasis
GO:0051480 IEA:Ensembl P cytosolic calcium ion homeostasis
GO:0006897 TAS:MGI P endocytosis
GO:0000188 IMP:MGI P inactivation of MAPK activity
GO:0007595 IMP:MGI P lactation
GO:0019915 IMP:MGI P lipid storage
GO:0030879 IMP:MGI P mammary gland development
GO:0060056 IMP:MGI P mammary gland involution
GO:0051899 IMP:MGI P membrane depolarization
GO:0030514 IEA:Ensembl P negative regulation of BMP signaling pathway
GO:0046426 IDA:MGI P negative regulation of JAK-STAT cascade
GO:0043407 IMP:MGI P negative regulation of MAP kinase activity
GO:0043409 IMP:MGI P negative regulation of MAPK cascade
GO:2000811 IMP:UniProtKB P negative regulation of anoikis
GO:0090090 IDA:UniProtKB P negative regulation of canonical Wnt signaling pathway
GO:0008285 IMP:MGI P negative regulation of cell proliferation
GO:0001960 IMP:MGI P negative regulation of cytokine-mediated signaling pathway
GO:0001937 IMP:MGI P negative regulation of endothelial cell proliferation
GO:0030857 IMP:MGI P negative regulation of epithelial cell differentiation
GO:0045019 IMP:MGI P negative regulation of nitric oxide biosynthetic process
GO:0051001 IMP:MGI P negative regulation of nitric-oxide synthase activity
GO:0033137 IEA:Ensembl P negative regulation of peptidyl-serine phosphorylation
GO:0048550 IEA:Ensembl P negative regulation of pinocytosis
GO:0032091 IEA:Ensembl P negative regulation of protein binding
GO:0031397 IMP:UniProtKB P negative regulation of protein ubiquitination
GO:0009968 IDA:MGI P negative regulation of signal transduction
GO:0000122 IDA:UniProtKB P negative regulation of transcription from RNA polymerase II promoter
GO:0042524 IDA:MGI P negative regulation of tyrosine phosphorylation of Stat5 protein
GO:0033484 IMP:MGI P nitric oxide homeostasis
GO:0010524 IDA:BHF-UCL P positive regulation of calcium ion transport into cytosol
GO:0090263 IEA:Ensembl P positive regulation of canonical Wnt signaling pathway
GO:2001238 IEA:Ensembl P positive regulation of extrinsic apoptotic signaling pathway
GO:2001244 IEA:Ensembl P positive regulation of intrinsic apoptotic signaling pathway
GO:0048554 IMP:MGI P positive regulation of metalloenzyme activity
GO:0010952 IMP:GOC P positive regulation of peptidase activity
GO:0033138 IEA:Ensembl P positive regulation of peptidyl-serine phosphorylation
GO:0045907 IMP:MGI P positive regulation of vasoconstriction
GO:0051260 IDA:MGI P protein homooligomerization
GO:0008104 IMP:MGI P protein localization
GO:0051259 IDA:MGI P protein oligomerization
GO:2000286 IEA:Ensembl P receptor internalization involved in canonical Wnt signaling pathway
GO:0030193 IEA:Ensembl P regulation of blood coagulation
GO:0019217 IMP:MGI P regulation of fatty acid metabolic process
GO:0052547 IMP:MGI P regulation of peptidase activity
GO:0006940 IMP:MGI P regulation of smooth muscle contraction
GO:0002026 IMP:MGI P regulation of the force of heart contraction
GO:0003057 IGI:MGI P regulation of the force of heart contraction by chemical signal
GO:0051592 IDA:BHF-UCL P response to calcium ion
GO:0043627 IDA:MGI P response to estrogen
GO:0001666 IMP:MGI P response to hypoxia
GO:0002931 IMP:MGI P response to ischemia
GO:0032570 ISO:MGI P response to progesterone
GO:0007519 IMP:MGI P skeletal muscle tissue development
GO:0006641 IMP:MGI P triglyceride metabolic process
GO:0001570 IMP:MGI P vasculogenesis
GO:0042310 IMP:MGI P vasoconstriction
GO:0016050 IEA:Ensembl P vesicle organization

KEGG Pathway Links

KEGG Pathway ID Description
mmu05205 Proteoglycans in cancer

Domain Information

InterPro Annotations

Accession Description
IPR001612 Caveolin
IPR018361 Caveolin, conserved site
IPR015504 Caveolin_1

UniProt Annotations

Entry Information

Gene Name
caveolin 1, caveolae protein
Protein Entry
CAV1_MOUSE
UniProt ID
P49817
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative initiation; Named isoforms=2; Name=1; IsoId=P49817-1; Sequence=Displayed; Name=2; IsoId=P49817-2; Sequence=VSP_018693;
Function Involved in the costimulatory signal essential for T- cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. May act as a scaffolding protein within caveolar membranes. Interacts directly with G- protein alpha subunits and can functionally regulate their activity. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. {ECO:0000269|PubMed:10816572}.
Interaction Q07820:MCL1 (xeno); NbExp=3; IntAct=EBI-1161338, EBI-1003422; P22307:SCP2 (xeno); NbExp=3; IntAct=EBI-1161338, EBI-1050999;
Ptm Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress. {ECO:0000269|PubMed:12036959, ECO:0000269|PubMed:12531427}.
Ptm The N-terminus of both isoforms are blocked.
Similarity Belongs to the caveolin family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Cell membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Membrane, caveola {ECO:0000269|PubMed:21610094}; Peripheral membrane protein {ECO:0000269|PubMed:21610094}. Membrane raft {ECO:0000250}. Note=Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae (By similarity). {ECO:0000250}.
Subunit Homooligomer (By similarity). Interacts (via the N- terminus) with DPP4; the interaction is direct (By similarity). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Interacts with BMX, BTK, CTNNB1, CDH1, GLIPR2, JUP, NOSTRIN, SNAP25 and STX1A. Interacts with SLC7A9 (By similarity). Interacts with PACSIN2. {ECO:0000250, ECO:0000269|PubMed:21610094}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000549 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6680854 RefSeq NP_031642 178 caveolin-1 isoform 1
340139110 RefSeq NP_001229993 147 caveolin-1 isoform 2

Identical Sequences to LMP000549 proteins

Reference Database Accession Length Protein Name
GI:340139110 DBBJ BAA89462.1 147 caveolin-1 beta isoform [Mus musculus]
GI:340139110 DBBJ BAC41079.1 147 unnamed protein product [Mus musculus]
GI:6680854 GenBank AAR99702.1 178 caveolin 1 alpha [Mus musculus]
GI:6680854 GenBank AAH38280.1 178 Caveolin 1, caveolae protein [Mus musculus]
GI:6680854 GenBank ABK42153.1 178 caveolin-1 [synthetic construct]
GI:6680854 GenBank EDL13883.1 178 caveolin, caveolae protein 1, isoform CRA_a [Mus musculus]
GI:340139110 GenBank EDL13884.1 147 caveolin, caveolae protein 1, isoform CRA_b [Mus musculus]
GI:340139110 GenBank EDL13885.1 147 caveolin, caveolae protein 1, isoform CRA_b [Mus musculus]
GI:6680854 GenBank EDL13887.1 178 caveolin, caveolae protein 1, isoform CRA_a [Mus musculus]
GI:6680854 RefSeq XP_006505037.1 178 PREDICTED: caveolin-1 isoform X1 [Mus musculus]
GI:340139110 RefSeq XP_006505038.1 147 PREDICTED: caveolin-1 isoform X2 [Mus musculus]
GI:340139110 RefSeq XP_006505039.1 147 PREDICTED: caveolin-1 isoform X3 [Mus musculus]

Related Sequences to LMP000549 proteins

Reference Database Accession Length Protein Name
GI:340139110 DBBJ BAC26091.1 178 unnamed protein product [Mus musculus]
GI:6680854 DBBJ BAC29118.1 178 unnamed protein product [Mus musculus]
GI:340139110 GenBank AAA85784.1 178 caveolin-1 [Mus musculus]
GI:6680854 GenBank AAR16308.1 178 caveolin 1 [Rattus norvegicus]
GI:340139110 GenBank AAH38280.1 178 Caveolin 1, caveolae protein [Mus musculus]
GI:340139110 GenBank EDL13883.1 178 caveolin, caveolae protein 1, isoform CRA_a [Mus musculus]
GI:340139110 GenBank EDL13887.1 178 caveolin, caveolae protein 1, isoform CRA_a [Mus musculus]
GI:6680854 GenBank EDM15110.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:6680854 GenBank EDM15111.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:6680854 RefSeq NP_113744.2 178 caveolin-1 isoform alpha [Rattus norvegicus]
GI:6680854 RefSeq XP_004658626.1 178 PREDICTED: caveolin-1 [Jaculus jaculus]
GI:340139110 SwissProt P49817.1 178 RecName: Full=Caveolin-1 [Mus musculus]