Gene/Proteome Database (LMPD)

LMPD ID
LMP000595
Gene ID
108097
Species
Mus musculus (Mouse)
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Prkab2
Synonyms
5730553K21Rik; AW049591; BB124140
Alternate Names
5'-AMP-activated protein kinase subunit beta-2;,AMPK subunit beta-2
Chromosome
3
Map Location
3 F2.2|3

Proteins

5'-AMP-activated protein kinase subunit beta-2
Refseq ID NP_892042
Protein GI 72384347
UniProt ID Q6PAM0
mRNA ID NM_182997
Length 271
RefSeq Status PROVISIONAL
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

Gene Information

Entrez Gene ID
108097
Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene Symbol
Prkab2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031588 ISS:UniProtKB C AMP-activated protein kinase complex
GO:0005829 TAS:Reactome C cytosol
GO:0004679 TAS:MGI F AMP-activated protein kinase activity
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu04152 AMPK signaling pathway
mmu04068 FoxO signaling pathway
mmu04932 Non-alcoholic fatty liver disease (NAFLD)
mmu04921 Oxytocin signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR006828 Association with the SNF1 complex (ASC) domain
IPR014756 Immunoglobulin E-set

UniProt Annotations

Entry Information

Gene Name
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Entry
AAKB2_MOUSE
UniProt ID
Q6PAM0
Species
Mouse

Comments

Comment Type Description
Function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3) (By similarity). {ECO:0000250}.
Ptm Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. {ECO:0000269|PubMed:21460634}.
Similarity Belongs to the 5'-AMP-activated protein kinase beta subunit family. {ECO:0000305}.
Subunit AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000595 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
72384347 RefSeq NP_892042 271 5'-AMP-activated protein kinase subunit beta-2

Identical Sequences to LMP000595 proteins

Reference Database Accession Length Protein Name
GI:72384347 GenBank AAH60228.1 271 Protein kinase, AMP-activated, beta 2 non-catalytic subunit [Mus musculus]
GI:72384347 GenBank EDL38940.1 271 protein kinase, AMP-activated, beta 2 non-catalytic subunit, isoform CRA_a [Mus musculus]
GI:72384347 RefSeq XP_006500903.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Mus musculus]
GI:72384347 SwissProt Q6PAM0.1 271 RecName: Full=5'-AMP-activated protein kinase subunit beta-2; Short=AMPK subunit beta-2 [Mus musculus]

Related Sequences to LMP000595 proteins

Reference Database Accession Length Protein Name
GI:72384347 GenBank EDL85582.1 271 protein kinase, AMP-activated, beta 2 non-catalytic subunit, isoform CRA_a [Rattus norvegicus]
GI:72384347 RefSeq NP_072149.1 271 5'-AMP-activated protein kinase subunit beta-2 [Rattus norvegicus]
GI:72384347 RefSeq XP_005084283.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Mesocricetus auratus]
GI:72384347 RefSeq XP_005357129.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 [Microtus ochrogaster]
GI:72384347 RefSeq XP_006233073.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Rattus norvegicus]
GI:72384347 RefSeq XP_006233074.1 271 PREDICTED: 5'-AMP-activated protein kinase subunit beta-2 isoform X1 [Rattus norvegicus]