Gene/Proteome Database (LMPD)
LMPD ID
LMP000597
Gene ID
Species
Homo sapiens (Human)
Gene Name
inositol hexakisphosphate kinase 1
Gene Symbol
Synonyms
IHPK1; PiUS
Alternate Names
inositol hexakisphosphate kinase 1; insP6 kinase 1; Pi uptake stimulator; inositol hexaphosphate kinase 1; ATP:1D-myo-inositol-hexakisphosphate phosphotransferase
Chromosome
3
Map Location
3p21.31
EC Number
2.7.4.21
Summary
This gene encodes a member of the inositol phosphokinase family. The encoded protein may be responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2011]
Orthologs
Proteins
inositol hexakisphosphate kinase 1 isoform 1 | |
---|---|
Refseq ID | NP_695005 |
Protein GI | 23510335 |
UniProt ID | Q92551 |
mRNA ID | NM_153273 |
Length | 441 |
RefSeq Status | REVIEWED |
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYESLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRRSLHRSGSGSDHKEEKASLSLETSESSQEAKSPKVELHSHSEVPFQMLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ |
inositol hexakisphosphate kinase 1 isoform 1 | |
---|---|
Refseq ID | NP_001229758 |
Protein GI | 338827648 |
UniProt ID | Q92551 |
mRNA ID | NM_001242829 |
Length | 441 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:23510335 (mRNA isoform) |
inositol hexakisphosphate kinase 1 isoform 2 | |
---|---|
Refseq ID | NP_001006115 |
Protein GI | 55769518 |
UniProt ID | Q92551 |
mRNA ID | NM_001006115 |
Length | 276 |
RefSeq Status | REVIEWED |
MLDGNSGLSSEKISHNPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEKAARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNGLDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDENQ |
Gene Information
Entrez Gene ID
Gene Name
inositol hexakisphosphate kinase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0005730 | IDA:HPA | C | nucleolus |
GO:0005654 | TAS:Reactome | C | nucleoplasm |
GO:0005634 | IDA:HPA | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0052723 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 1-kinase activity |
GO:0052724 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 3-kinase activity |
GO:0000832 | IEA:UniProtKB-EC | F | inositol hexakisphosphate 5-kinase activity |
GO:0008440 | IEA:InterPro | F | inositol-1,4,5-trisphosphate 3-kinase activity |
GO:0043647 | TAS:Reactome | P | inositol phosphate metabolic process |
GO:0046854 | IDA:UniProtKB | P | phosphatidylinositol phosphorylation |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6369 | inositol pyrophosphates biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_150154 | Inositol phosphate metabolism |
REACT_150275 | Synthesis of IPs in the nucleus |
REACT_150188 | Synthesis of pyrophosphates in the cytosol |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Gene Name
inositol hexakisphosphate kinase 1
Protein Entry
IP6K1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92551-1; Sequence=Displayed; Name=2; IsoId=Q92551-2; Sequence=VSP_042756; |
Catalytic Activity | ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6- pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate. |
Catalytic Activity | ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate. |
Function | Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. |
Sequence Caution | Sequence=BAA13393.2; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the inositol phosphokinase (IPK) family. |
Subcellular Location | Cytoplasm . Nucleus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP000597 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
23510335 | RefSeq | NP_695005 | 441 | inositol hexakisphosphate kinase 1 isoform 1 |
55769518 | RefSeq | NP_001006115 | 276 | inositol hexakisphosphate kinase 1 isoform 2 |
Identical Sequences to LMP000597 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:23510335 | DBBJ | BAF82461.1 | 441 | unnamed protein product [Homo sapiens] |
GI:23510335 | DBBJ | BAG09681.1 | 441 | inositol hexaphosphate kinase 1, partial [synthetic construct] |
GI:55769518 | DBBJ | BAG58541.1 | 276 | unnamed protein product [Homo sapiens] |
GI:23510335 | GenBank | EAW65020.1 | 441 | inositol hexaphosphate kinase 1, isoform CRA_a [Homo sapiens] |
GI:55769518 | GenBank | AHD75170.1 | 276 | Sequence 16449 from patent US 8586006 |
GI:23510335 | GenBank | AHD75171.1 | 441 | Sequence 16450 from patent US 8586006 |
GI:23510335 | GenBank | AIC62664.1 | 441 | IP6K1, partial [synthetic construct] |
GI:23510335 | RefSeq | NP_001229758.1 | 441 | inositol hexakisphosphate kinase 1 isoform 1 [Homo sapiens] |
GI:55769518 | RefSeq | XP_004034207.1 | 276 | PREDICTED: inositol hexakisphosphate kinase 1 isoform 2 [Gorilla gorilla gorilla] |
GI:55769518 | RefSeq | XP_004034208.1 | 276 | PREDICTED: inositol hexakisphosphate kinase 1 isoform 3 [Gorilla gorilla gorilla] |
Related Sequences to LMP000597 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:23510335 | DBBJ | BAA13393.2 | 462 | KIAA0263 protein, partial [Homo sapiens] |
GI:55769518 | DBBJ | BAA13393.2 | 462 | KIAA0263 protein, partial [Homo sapiens] |
GI:55769518 | DBBJ | BAG09681.1 | 441 | inositol hexaphosphate kinase 1, partial [synthetic construct] |
GI:55769518 | GenBank | AAH12944.1 | 441 | Inositol hexakisphosphate kinase 1 [Homo sapiens] |
GI:55769518 | GenBank | EAW65016.1 | 441 | inositol hexaphosphate kinase 1, isoform CRA_a [Homo sapiens] |
GI:55769518 | GenBank | EAW65018.1 | 441 | inositol hexaphosphate kinase 1, isoform CRA_a [Homo sapiens] |
GI:23510335 | GenBank | EHH16357.1 | 441 | hypothetical protein EGK_11628 [Macaca mulatta] |
GI:55769518 | RefSeq | NP_695005.1 | 441 | inositol hexakisphosphate kinase 1 isoform 1 [Homo sapiens] |
GI:23510335 | RefSeq | XP_003257126.1 | 441 | PREDICTED: inositol hexakisphosphate kinase 1 [Nomascus leucogenys] |
GI:23510335 | RefSeq | XP_001166017.2 | 441 | PREDICTED: inositol hexakisphosphate kinase 1 [Pan troglodytes] |
GI:23510335 | RefSeq | XP_008970500.1 | 441 | PREDICTED: inositol hexakisphosphate kinase 1 [Pan paniscus] |
GI:23510335 | RefSeq | XP_008970501.1 | 441 | PREDICTED: inositol hexakisphosphate kinase 1 [Pan paniscus] |