Gene/Proteome Database (LMPD)
LMPD ID
LMP000618
Gene ID
Species
Homo sapiens (Human)
Gene Name
mediator complex subunit 4
Gene Symbol
Synonyms
ARC36; DRIP36; HSPC126; TRAP36; VDRIP
Alternate Names
mediator of RNA polymerase II transcription subunit 4; TRAP/SMCC/PC2 subunit p36; mediator, 34-kD subunit, homolog; activator-recruited cofactor 36 kDa component; vitamin D receptor-interacting protein, 36-kD; vitamin D3 receptor-interacting protein complex 36 kDa component
Chromosome
13
Map Location
13q14.2
Summary
This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Orthologs
Proteins
| mediator of RNA polymerase II transcription subunit 4 isoform 1 | |
|---|---|
| Refseq ID | NP_054885 |
| Protein GI | 7661788 |
| UniProt ID | Q9NPJ6 |
| mRNA ID | NM_014166 |
| Length | 270 |
| RefSeq Status | REVIEWED |
| MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD | |
| mediator of RNA polymerase II transcription subunit 4 isoform 2 | |
|---|---|
| Refseq ID | NP_001257558 |
| Protein GI | 397739073 |
| UniProt ID | Q9NPJ6 |
| mRNA ID | NM_001270629 |
| Length | 224 |
| RefSeq Status | REVIEWED |
| MLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016592 | IDA:UniProtKB | C | mediator complex |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0001104 | IDA:UniProtKB | F | RNA polymerase II transcription cofactor activity |
| GO:0030374 | NAS:UniProtKB | F | ligand-dependent nuclear receptor transcription coactivator activity |
| GO:0004872 | IDA:UniProtKB | F | receptor activity |
| GO:0046966 | IDA:UniProtKB | F | thyroid hormone receptor binding |
| GO:0003712 | IDA:UniProtKB | F | transcription cofactor activity |
| GO:0042809 | NAS:UniProtKB | F | vitamin D receptor binding |
| GO:0030521 | IDA:UniProtKB | P | androgen receptor signaling pathway |
| GO:0010467 | TAS:Reactome | P | gene expression |
| GO:0030518 | IDA:UniProtKB | P | intracellular steroid hormone receptor signaling pathway |
| GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
| GO:0006366 | IDA:UniProtKB | P | transcription from RNA polymerase II promoter |
| GO:0006367 | IDA:UniProtKB | P | transcription initiation from RNA polymerase II promoter |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04919 | Thyroid hormone signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_116145 | PPARA activates gene expression |
| REACT_19241 | Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) |
| REACT_27161 | Transcriptional regulation of white adipocyte differentiation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019258 | Mediator complex, subunit Med4 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NPJ6-1; Sequence=Displayed; Name=2; IsoId=Q9NPJ6-2; Sequence=VSP_047072; |
| Function | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. |
| Interaction | Q93074:MED12; NbExp=5; IntAct=EBI-394607, EBI-394357; Q9NWA0:MED9; NbExp=8; IntAct=EBI-394607, EBI-394653; |
| Similarity | Belongs to the Mediator complex subunit 4 family. |
| Subcellular Location | Nucleus. |
| Subunit | Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000618 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7661788 | RefSeq | NP_054885 | 270 | mediator of RNA polymerase II transcription subunit 4 isoform 1 |
| 397739073 | RefSeq | NP_001257558 | 224 | mediator of RNA polymerase II transcription subunit 4 isoform 2 |
Identical Sequences to LMP000618 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:397739073 | DBBJ | BAG73380.1 | 224 | mediator complex subunit 4, partial [synthetic construct] |
| GI:7661788 | GenBank | EAX08784.1 | 270 | mediator of RNA polymerase II transcription, subunit 4 homolog (yeast), isoform CRA_b [Homo sapiens] |
| GI:7661788 | GenBank | EAX08785.1 | 270 | mediator of RNA polymerase II transcription, subunit 4 homolog (yeast), isoform CRA_b [Homo sapiens] |
| GI:7661788 | GenBank | AEK14791.1 | 270 | Sequence 129 from patent US 7973135 |
| GI:7661788 | RefSeq | XP_002824305.1 | 270 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform X1 [Pongo abelii] |
| GI:397739073 | RefSeq | XP_002824306.1 | 224 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform X2 [Pongo abelii] |
| GI:397739073 | RefSeq | XP_003270118.1 | 224 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform 2 [Nomascus leucogenys] |
| GI:7661788 | RefSeq | XP_003811468.1 | 270 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform X1 [Pan paniscus] |
| GI:397739073 | RefSeq | XP_003811469.1 | 224 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform X2 [Pan paniscus] |
| GI:7661788 | RefSeq | XP_004054541.1 | 270 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform 1 [Gorilla gorilla gorilla] |
| GI:397739073 | RefSeq | XP_004054542.1 | 224 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform 2 [Gorilla gorilla gorilla] |
| GI:397739073 | RefSeq | XP_004054543.1 | 224 | PREDICTED: mediator of RNA polymerase II transcription subunit 4 isoform 3 [Gorilla gorilla gorilla] |
Related Sequences to LMP000618 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:397739073 | DBBJ | BAA91987.1 | 270 | unnamed protein product [Homo sapiens] |
| GI:7661788 | DBBJ | BAD96737.1 | 270 | mediator of RNA polymerase II transcription, subunit 4 homolog, partial [Homo sapiens] |
| GI:397739073 | EMBL | CAE89906.1 | 270 | unnamed protein product [Homo sapiens] |
| GI:7661788 | EMBL | CAG33557.1 | 270 | VDRIP [Homo sapiens] |
| GI:397739073 | GenBank | AAF29090.1 | 270 | HSPC126 [Homo sapiens] |
| GI:7661788 | GenBank | AAF37289.1 | 270 | p36 TRAP/SMCC/PC2 subunit [Homo sapiens] |
| GI:397739073 | GenBank | AAG22542.1 | 270 | vitamin D receptor-interacting protein complex component DRIP36 [Homo sapiens] |
| GI:7661788 | GenBank | EHH29010.1 | 270 | Mediator complex subunit 4 [Macaca mulatta] |
| GI:7661788 | GenBank | AFJ70438.1 | 270 | mediator of RNA polymerase II transcription subunit 4 [Macaca mulatta] |
| GI:397739073 | RefSeq | NP_054885.1 | 270 | mediator of RNA polymerase II transcription subunit 4 isoform 1 [Homo sapiens] |
| GI:7661788 | RefSeq | NP_001252711.1 | 270 | mediator of RNA polymerase II transcription subunit 4 [Macaca mulatta] |
| GI:397739073 | SwissProt | Q9NPJ6.1 | 270 | RecName: Full=Mediator of RNA polymerase II transcription subunit 4; AltName: Full=Activator-recruited cofactor 36 kDa component; Short=ARC36; AltName: Full=Mediator complex subunit 4; AltName: Full=TRAP/SMCC/PC2 subunit p36 subunit; AltName: Full=Vitamin D3 receptor-interacting protein complex 36 kDa component; Short=DRIP36 [Homo sapiens] |