Gene/Proteome Database (LMPD)

LMPD ID
LMP000634
Gene ID
16975
Species
Mus musculus (Mouse)
Gene Name
low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Gene Symbol
Lrp8
Synonyms
4932703M08Rik; AA921429; AI848122; ApoER2; Lr8b
Chromosome
4
Map Location
4 C7|4

Proteins

low-density lipoprotein receptor-related protein 8 precursor
Refseq ID NP_001074395
Protein GI 124286870
UniProt ID B1AXJ3
mRNA ID NM_001080926
Length 870
RefSeq Status VALIDATED
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEECPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTSAPGPCRENEFQCGDGTCVLAIKRCNQERDCPDGSDEAGCLQESTCEGPRRFQCKSGECVDGGKVCDDQRDCRDWSDEPQKVCGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECQDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASAMTRTVPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSVNVPRAPSTSPSTPSPATSNHSQHYGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEEEDELHIGRTAQIGHVYPAAISNYDRPLWAEPCLGETRDLEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2951 peptide sequence: MGRPELGALRPLALLLLLLLQLQHLSA

Gene Information

Entrez Gene ID
16975
Gene Name
low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Gene Symbol
Lrp8
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030424 IEA:Ensembl C axon
GO:0005901 IEA:Ensembl C caveola
GO:0030425 IEA:Ensembl C dendrite
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005875 IEA:Ensembl C microtubule associated complex
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0005886 TAS:MGI C plasma membrane
GO:0014069 IEA:Ensembl C postsynaptic density
GO:0043235 ISO:MGI C receptor complex
GO:0005509 IEA:InterPro F calcium ion binding
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0005041 TAS:MGI F low-density lipoprotein receptor activity
GO:0030229 IEA:Ensembl F very-low-density lipoprotein particle receptor activity
GO:0071397 IEA:Ensembl P cellular response to cholesterol
GO:0071363 IEA:Ensembl P cellular response to growth factor stimulus
GO:0021766 IGI:MGI P hippocampus development
GO:0021819 IGI:MGI P layer formation in cerebral cortex
GO:0045860 IGI:MGI P positive regulation of protein kinase activity
GO:0042493 IEA:Ensembl P response to drug

Domain Information

InterPro Annotations

Accession Description
IPR001881 EGF-like calcium-binding domain
IPR018097 EGF-like calcium-binding, conserved site
IPR013032 EGF-like, conserved site
IPR000152 EGF-type aspartate/asparagine hydroxylation site
IPR000742 Epidermal growth factor-like domain
IPR000033 LDLR class B repeat
IPR002172 Low-density lipoprotein (LDL) receptor class A repeat
IPR023415 Low-density lipoprotein (LDL) receptor class A, conserved site
IPR011042 Six-bladed beta-propeller, TolB-like

UniProt Annotations

Entry Information

Gene Name
low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Protein Entry
B1AXJ3_MOUSE
UniProt ID
B1AXJ3
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP000634 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
124286870 RefSeq NP_001074395 870 low-density lipoprotein receptor-related protein 8 precursor

Identical Sequences to LMP000634 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP000634 proteins

Reference Database Accession Length Protein Name
GI:124286870 EMBL CAC38356.1 870 ApoE receptor-2 [Mus musculus]
GI:124286870 RefSeq XP_342878.5 873 PREDICTED: low-density lipoprotein receptor-related protein 8 isoform X17 [Rattus norvegicus]
GI:124286870 RefSeq XP_005072209.1 873 PREDICTED: low-density lipoprotein receptor-related protein 8 isoform X5 [Mesocricetus auratus]
GI:124286870 RefSeq XP_005353586.1 872 PREDICTED: low-density lipoprotein receptor-related protein 8 isoform X3 [Microtus ochrogaster]
GI:124286870 RefSeq XP_008762165.1 960 PREDICTED: low-density lipoprotein receptor-related protein 8 isoform X9 [Rattus norvegicus]
GI:124286870 RefSeq XP_008762166.1 959 PREDICTED: low-density lipoprotein receptor-related protein 8 isoform X10 [Rattus norvegicus]