Gene/Proteome Database (LMPD)
LMPD ID
LMP000671
Gene ID
Species
Homo sapiens (Human)
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Synonyms
P23; TEBP; cPGES
Alternate Names
prostaglandin E synthase 3; Hsp90 co-chaperone; telomerase-binding protein p23; progesterone receptor complex p23; cytosolic prostaglandin E synthase; cytosolic prostaglandin E2 synthase; unactive progesterone receptor, 23 kD
Chromosome
12
Map Location
12q13.3|12
EC Number
5.3.99.3
Proteins
| prostaglandin E synthase 3 isoform a | |
|---|---|
| Refseq ID | NP_006592 |
| Protein GI | 23308579 |
| UniProt ID | Q15185 |
| mRNA ID | NM_006601 |
| Length | 160 |
| RefSeq Status | VALIDATED |
| MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE | |
| prostaglandin E synthase 3 isoform b | |
|---|---|
| Refseq ID | NP_001269530 |
| Protein GI | 543583723 |
| UniProt ID | Q15185 |
| mRNA ID | NM_001282601 |
| Length | 139 |
| RefSeq Status | VALIDATED |
| MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEDSQDSDDEKMPDLE | |
| prostaglandin E synthase 3 isoform c | |
|---|---|
| Refseq ID | NP_001269531 |
| Protein GI | 543583693 |
| UniProt ID | Q15185 |
| mRNA ID | NM_001282602 |
| Length | 130 |
| RefSeq Status | VALIDATED |
| MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE | |
| prostaglandin E synthase 3 isoform d | |
|---|---|
| Refseq ID | NP_001269532 |
| Protein GI | 543583707 |
| UniProt ID | Q15185 |
| mRNA ID | NM_001282603 |
| Length | 127 |
| RefSeq Status | VALIDATED |
| MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE | |
| prostaglandin E synthase 3 isoform e | |
|---|---|
| Refseq ID | NP_001269533 |
| Protein GI | 543583697 |
| UniProt ID | Q15185 |
| mRNA ID | NM_001282604 |
| Length | 164 |
| RefSeq Status | VALIDATED |
| MSLEKQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE | |
| prostaglandin E synthase 3 isoform f | |
|---|---|
| Refseq ID | NP_001269534 |
| Protein GI | 543583725 |
| UniProt ID | Q15185 |
| mRNA ID | NM_001282605 |
| Length | 109 |
| RefSeq Status | VALIDATED |
| MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKDSQDSDDEKMPDLE | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000781 | IC:UniProtKB | C | chromosome, telomeric region |
| GO:0005737 | IDA:HPA | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0005634 | IDA:UniProt | C | nucleus |
| GO:0005697 | IDA:UniProtKB | C | telomerase holoenzyme complex |
| GO:0050220 | IDA:UniProtKB | F | prostaglandin-E synthase activity |
| GO:0003720 | IDA:UniProtKB | F | telomerase activity |
| GO:0051082 | IDA:UniProtKB | F | unfolded protein binding |
| GO:0006278 | IDA:GOC | P | RNA-dependent DNA replication |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0008283 | IEA:Ensembl | P | cell proliferation |
| GO:0070389 | IDA:UniProtKB | P | chaperone cofactor-dependent protein refolding |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:0042921 | IEA:Ensembl | P | glucocorticoid receptor signaling pathway |
| GO:0005978 | IEA:Ensembl | P | glycogen biosynthetic process |
| GO:0060430 | IEA:Ensembl | P | lung saccule development |
| GO:0001516 | IDA:UniProtKB | P | prostaglandin biosynthetic process |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0043588 | IEA:Ensembl | P | skin development |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0000723 | TAS:UniProtKB | P | telomere maintenance |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_200624 | Attenuation phase |
| REACT_200744 | HSF1 activation |
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E synthase 3 (cytosolic)
Protein Entry
TEBP_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q15185-1; Sequence=Displayed; Name=2; IsoId=Q15185-2; Sequence=VSP_055363; Note=No experimental confirmation available.; Name=3; IsoId=Q15185-3; Sequence=VSP_055364; Note=No experimental confirmation available.; Name=4; IsoId=Q15185-4; Sequence=VSP_055365; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=14 uM for PGH2 ; Vmax=190 nmol/min/mg enzyme toward PGH2 ; |
| Catalytic Activity | (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate. |
| Domain | The PXLE motif mediates interaction with EGLN1/PHD2. |
| Function | Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) (PubMed:10922363). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes (PubMed:11274138, PubMed:12077419). Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway (PubMed:24711448). {ECO |
| Interaction | Q9UKV8:AGO2; NbExp=3; IntAct=EBI-1049387, EBI-528269; P07900:HSP90AA1; NbExp=6; IntAct=EBI-1049387, EBI-296047; O14654:IRS4; NbExp=2; IntAct=EBI-1049387, EBI-356594; |
| Pathway | Lipid metabolism; prostaglandin biosynthesis. |
| Similarity | Belongs to the p23/wos2 family. |
| Similarity | Contains 1 CS domain. {ECO |
| Subcellular Location | Cytoplasm. |
| Subunit | Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required for correct assembly and stabilization of the telomerase holoenzyme complex. Interacts (via PXLE motif) with EGLN1/PHD2, recruiting EGLN1/PHD2 to the HSP90 pathway to facilitate HIF alpha proteins hydroxylation. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000671 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 23308579 | RefSeq | NP_006592 | 160 | prostaglandin E synthase 3 isoform a |
| 543583723 | RefSeq | NP_001269530 | 139 | prostaglandin E synthase 3 isoform b |
| 543583693 | RefSeq | NP_001269531 | 130 | prostaglandin E synthase 3 isoform c |
| 543583707 | RefSeq | NP_001269532 | 127 | prostaglandin E synthase 3 isoform d |
| 543583697 | RefSeq | NP_001269533 | 164 | prostaglandin E synthase 3 isoform e |
| 543583725 | RefSeq | NP_001269534 | 109 | prostaglandin E synthase 3 isoform f |
Identical Sequences to LMP000671 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23308579 | GenBank | AIC50706.1 | 160 | PTGES3, partial [synthetic construct] |
| GI:543583697 | RefSeq | XP_003252842.1 | 164 | PREDICTED: prostaglandin E synthase 3 isoform 3 [Nomascus leucogenys] |
| GI:543583725 | RefSeq | XP_005960808.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X6 [Pantholops hodgsonii] |
| GI:543583725 | RefSeq | XP_006093682.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Myotis lucifugus] |
| GI:543583723 | RefSeq | XP_006218663.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Vicugna pacos] |
| GI:543583725 | RefSeq | XP_006218666.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Vicugna pacos] |
| GI:543583707 | RefSeq | XP_006859514.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Chrysochloris asiatica] |
| GI:543583723 | RefSeq | XP_007467761.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Lipotes vexillifer] |
| GI:543583707 | RefSeq | XP_007467763.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X4 [Lipotes vexillifer] |
| GI:543583725 | RefSeq | XP_007467764.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Lipotes vexillifer] |
| GI:543583707 | RefSeq | XP_007522660.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Erinaceus europaeus] |
| GI:543583693 | RefSeq | XP_007533385.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Erinaceus europaeus] |
| GI:543583707 | RefSeq | XP_007533386.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Erinaceus europaeus] |
| GI:543583723 | RefSeq | XP_007953336.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Orycteropus afer afer] |
| GI:543583693 | RefSeq | XP_007953337.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Orycteropus afer afer] |
| GI:543583707 | RefSeq | XP_007953338.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X4 [Orycteropus afer afer] |
| GI:543583725 | RefSeq | XP_007953339.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Orycteropus afer afer] |
| GI:543583723 | RefSeq | XP_008001893.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Chlorocebus sabaeus] |
| GI:543583693 | RefSeq | XP_008001895.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Chlorocebus sabaeus] |
| GI:23308579 | RefSeq | XP_008146881.1 | 160 | PREDICTED: prostaglandin E synthase 3 isoform X1 [Eptesicus fuscus] |
| GI:543583723 | RefSeq | XP_008146882.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Eptesicus fuscus] |
| GI:543583693 | RefSeq | XP_008146883.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Eptesicus fuscus] |
| GI:543583707 | RefSeq | XP_008146884.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X4 [Eptesicus fuscus] |
| GI:543583725 | RefSeq | XP_008146885.1 | 109 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Eptesicus fuscus] |
| GI:23308579 | RefSeq | XP_002711223.2 | 160 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Oryctolagus cuniculus] |
| GI:23308579 | RefSeq | XP_008681905.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Ursus maritimus] |
| GI:543583693 | RefSeq | XP_008976810.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X6 [Pan paniscus] |
| GI:543583723 | RefSeq | XP_009423235.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X6 [Pan troglodytes] |
| GI:543583693 | RefSeq | XP_009423241.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X12 [Pan troglodytes] |
| GI:23308579 | RefSeq | XP_010376073.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Rhinopithecus roxellana] |
| GI:23308579 | RefSeq | XP_010642954.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Fukomys damarensis] |
Related Sequences to LMP000671 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:543583697 | GenBank | ADT47280.1 | 164 | Sequence 941 from patent US 7842466 |
| GI:543583697 | GenBank | ADT49470.1 | 164 | Sequence 1487 from patent US 7842467 |
| GI:543583697 | GenBank | AEI18913.1 | 164 | Sequence 242 from patent US 7960100 |
| GI:23308579 | GenBank | AEI18913.1 | 164 | Sequence 242 from patent US 7960100 |
| GI:23308579 | GenBank | JAA42101.1 | 160 | prostaglandin E synthase 3 (cytosolic) [Pan troglodytes] |
| GI:543583707 | GenBank | KFO24558.1 | 1795 | Nascent polypeptide-associated complex subunit alpha, muscle-specific form [Fukomys damarensis] |
| GI:543583725 | RefSeq | XP_003252844.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform 5 [Nomascus leucogenys] |
| GI:23308579 | RefSeq | XP_003790584.1 | 160 | PREDICTED: prostaglandin E synthase 3 isoform 1 [Otolemur garnettii] |
| GI:543583707 | RefSeq | XP_003790585.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform 2 [Otolemur garnettii] |
| GI:543583693 | RefSeq | XP_003790586.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform 3 [Otolemur garnettii] |
| GI:543583723 | RefSeq | XP_003790587.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform 4 [Otolemur garnettii] |
| GI:543583725 | RefSeq | XP_004589740.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Ochotona princeps] |
| GI:543583725 | RefSeq | XP_004700601.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Echinops telfairi] |
| GI:543583723 | RefSeq | XP_004647111.1 | 139 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Octodon degus] |
| GI:543583707 | RefSeq | XP_004647112.1 | 127 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Octodon degus] |
| GI:543583707 | RefSeq | XP_004692490.1 | 131 | PREDICTED: prostaglandin E synthase 3 [Condylura cristata] |
| GI:23308579 | RefSeq | XP_004773209.1 | 442 | PREDICTED: uncharacterized protein LOC101670420 isoform X2 [Mustela putorius furo] |
| GI:23308579 | RefSeq | XP_004800700.1 | 442 | PREDICTED: uncharacterized protein LOC101670420 isoform X2 [Mustela putorius furo] |
| GI:543583693 | RefSeq | XP_005079790.1 | 130 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Mesocricetus auratus] |
| GI:543583723 | RefSeq | XP_005571315.1 | 143 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Macaca fascicularis] |
| GI:543583697 | RefSeq | XP_005680482.1 | 283 | PREDICTED: prostaglandin E synthase 3 [Capra hircus] |
| GI:543583697 | RefSeq | XP_006179929.1 | 309 | PREDICTED: prostaglandin E synthase 3 [Camelus ferus] |
| GI:543583725 | RefSeq | XP_006143256.1 | 115 | PREDICTED: prostaglandin E synthase 3-like isoform X2 [Tupaia chinensis] |
| GI:543583693 | RefSeq | XP_006719262.1 | 134 | PREDICTED: prostaglandin E synthase 3 isoform X8 [Homo sapiens] |
| GI:543583707 | RefSeq | XP_006903529.1 | 127 | PREDICTED: prostaglandin E synthase 3-like isoform X3 [Elephantulus edwardii] |
| GI:543583725 | RefSeq | XP_006903530.1 | 115 | PREDICTED: prostaglandin E synthase 3-like isoform X4 [Elephantulus edwardii] |
| GI:543583697 | RefSeq | XP_007081655.1 | 195 | PREDICTED: prostaglandin E synthase 3 [Panthera tigris altaica] |
| GI:543583725 | RefSeq | XP_007522668.1 | 115 | PREDICTED: prostaglandin E synthase 3 isoform X4 [Erinaceus europaeus] |
| GI:543583707 | RefSeq | XP_008144058.1 | 127 | PREDICTED: prostaglandin E synthase 3-like isoform X3 [Eptesicus fuscus] |
| GI:23308579 | RefSeq | XP_008573714.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Galeopterus variegatus] |
| GI:543583723 | RefSeq | XP_009002283.1 | 143 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Callithrix jacchus] |
| GI:543583693 | RefSeq | XP_008976809.1 | 134 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Pan paniscus] |
| GI:543583723 | RefSeq | XP_009179259.1 | 143 | PREDICTED: prostaglandin E synthase 3 isoform X3 [Papio anubis] |
| GI:543583693 | RefSeq | XP_009179260.1 | 134 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Papio anubis] |
| GI:543583723 | RefSeq | XP_009423233.1 | 143 | PREDICTED: prostaglandin E synthase 3 isoform X5 [Pan troglodytes] |
| GI:543583693 | RefSeq | XP_009423240.1 | 134 | PREDICTED: prostaglandin E synthase 3 isoform X11 [Pan troglodytes] |