Gene/Proteome Database (LMPD)
LMPD ID
LMP000690
Gene ID
Species
Homo sapiens (Human)
Gene Name
diacylglycerol kinase, alpha 80kDa
Gene Symbol
Synonyms
DAGK; DAGK1; DGK-alpha
Alternate Names
diacylglycerol kinase alpha; DAG kinase alpha; diglyceride kinase alpha; 80 kDa diacylglycerol kinase
Chromosome
12
Map Location
12q13.3
EC Number
2.7.1.107
Summary
The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| diacylglycerol kinase alpha | |
|---|---|
| Refseq ID | NP_001336 |
| Protein GI | 31542504 |
| UniProt ID | P23743 |
| mRNA ID | NM_001345 |
| Length | 735 |
| RefSeq Status | REVIEWED |
| MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS | |
| diacylglycerol kinase alpha | |
|---|---|
| Refseq ID | NP_958853 |
| Protein GI | 41872494 |
| UniProt ID | P23743 |
| mRNA ID | NM_201445 |
| Length | 735 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:31542504 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol kinase, alpha 80kDa
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0003951 | IEA:InterPro | F | NAD+ kinase activity |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004143 | TAS:ProtInc | F | diacylglycerol kinase activity |
| GO:0005543 | IEA:Ensembl | F | phospholipid binding |
| GO:0007596 | TAS:Reactome | P | blood coagulation |
| GO:0035556 | TAS:ProtInc | P | intracellular signal transduction |
| GO:0030168 | TAS:Reactome | P | platelet activation |
| GO:0007205 | IEA:InterPro | P | protein kinase C-activating G-protein coupled receptor signaling pathway |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016064 | ATP-NAD kinase-like domain |
| IPR029477 | Diacylglycerol kinase type I, N-terminal |
| IPR000756 | Diacylglycerol kinase, accessory domain |
| IPR001206 | Diacylglycerol kinase, catalytic domain |
| IPR018247 | EF-Hand 1, calcium-binding site |
| IPR002048 | EF-hand domain |
| IPR011992 | EF-hand domain pair |
| IPR002219 | Protein kinase C-like, phorbol ester/diacylglycerol-binding domain |
UniProt Annotations
Entry Information
Gene Name
diacylglycerol kinase, alpha 80kDa
Protein Entry
DGKA_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P23743-1; Sequence=Displayed; Name=2; IsoId=P23743-2; Sequence=VSP_032212, VSP_032213; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.; Name=3; IsoId=P23743-3; Sequence=VSP_047702, VSP_047703; |
| Catalytic Activity | ATP + 1,2-diacyl-sn-glycerol = ADP + 1,2- diacyl-sn-glycerol 3-phosphate. |
| Enzyme Regulation | Stimulated by calcium and phosphatidylserine. Phosphorylated by protein kinase C. |
| Function | Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. |
| Similarity | Belongs to the eukaryotic diacylglycerol kinase family. |
| Similarity | Contains 1 DAGKc domain. {ECO |
| Similarity | Contains 2 EF-hand domains. {ECO |
| Similarity | Contains 2 phorbol-ester/DAG-type zinc fingers. |
| Subunit | Monomer. |
| Tissue Specificity | Lymphocytes and oligodendroglial cells. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000690 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 31542504 | RefSeq | NP_001336 | 735 | diacylglycerol kinase alpha |
Identical Sequences to LMP000690 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31542504 | GenBank | JAA23933.1 | 735 | diacylglycerol kinase, alpha 80kDa [Pan troglodytes] |
| GI:31542504 | GenBank | JAA34707.1 | 735 | diacylglycerol kinase, alpha 80kDa [Pan troglodytes] |
| GI:31542504 | GenBank | JAA34708.1 | 735 | diacylglycerol kinase, alpha 80kDa [Pan troglodytes] |
| GI:31542504 | RefSeq | XP_004053380.1 | 735 | PREDICTED: diacylglycerol kinase alpha isoform 1 [Gorilla gorilla gorilla] |
| GI:31542504 | RefSeq | XP_004053381.1 | 735 | PREDICTED: diacylglycerol kinase alpha isoform 2 [Gorilla gorilla gorilla] |
| GI:31542504 | RefSeq | XP_004053382.1 | 735 | PREDICTED: diacylglycerol kinase alpha isoform 3 [Gorilla gorilla gorilla] |
Related Sequences to LMP000690 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31542504 | GenBank | AAQ02567.1 | 736 | diacylglycerol kinase, alpha 80kDa, partial [synthetic construct] |
| GI:31542504 | GenBank | ABM82643.1 | 735 | diacylglycerol kinase, alpha 80kDa [synthetic construct] |
| GI:31542504 | GenBank | ABM85820.1 | 735 | diacylglycerol kinase, alpha 80kDa, partial [synthetic construct] |
| GI:31542504 | GenBank | AIC54262.1 | 735 | DGKA, partial [synthetic construct] |
| GI:31542504 | GenBank | AIC62484.1 | 735 | DGKA, partial [synthetic construct] |
| GI:31542504 | RefSeq | XP_005268745.1 | 773 | PREDICTED: diacylglycerol kinase alpha isoform X1 [Homo sapiens] |