Gene/Proteome Database (LMPD)

LMPD ID
LMP000710
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Gene Symbol
Ebp
Synonyms
AI255399; Pabp; Td; mSI
Alternate Names
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; tattered; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase
Chromosome
X
Map Location
X A1.1|X 3.7 cM
EC Number
5.3.3.5

Proteins

3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Refseq ID NP_031924
Protein GI 6681255
UniProt ID P70245
mRNA ID NM_007898
Length 230
RefSeq Status PROVISIONAL
MTTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN

Gene Information

Entrez Gene ID
Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Gene Symbol
Ebp
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:MGI C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000247 IDA:MGI F C-8 sterol isomerase activity
GO:0047750 IEA:UniProtKB-EC F cholestenol delta-isomerase activity
GO:0006695 IEA:UniProtKB-UniPathway P cholesterol biosynthetic process
GO:0030097 IMP:MGI P hemopoiesis
GO:0016126 IMP:MGI P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu01100 Metabolic pathways
mmu00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893434 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR007905 Emopamil-binding protein

UniProt Annotations

Entry Information

Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Protein Entry
EBP_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol.
Disease Note=Defects in Ebp are a cause of 'Tattered' (Td) which is an X-linked, semidominant mouse mutation associated with prenatal male lethality. Heterozygous females are small and at 4 to 5 days of age develop patches of hyperkeratotic skin where no hair grows, resulting in a striping of the coat in adults. Craniofacial anomalies and twisted toes have also been observed in some affected females.
Function Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.
Miscellaneous Binds to the phenylalkylamine calcium-ion antagonist emopamil, an anti-ischemic drug.
Pathway Steroid biosynthesis; cholesterol biosynthesis.
Similarity Belongs to the EBP family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP000710 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6681255 RefSeq NP_031924 230 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

Identical Sequences to LMP000710 proteins

Reference Database Accession Length Protein Name
GI:6681255 DBBJ BAC25686.1 230 unnamed protein product [Mus musculus]
GI:6681255 EMBL CAE83481.1 230 unnamed protein product, partial [Mus musculus]
GI:6681255 GenBank EDL33961.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus]
GI:6681255 GenBank EDL33962.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus]
GI:6681255 GenBank EDL33963.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus]
GI:6681255 GenBank ADA21802.1 230 Sequence 2 from patent US 7608421

Related Sequences to LMP000710 proteins

Reference Database Accession Length Protein Name
GI:6681255 DBBJ BAB28129.1 213 unnamed protein product, partial [Mus musculus]
GI:6681255 GenBank AAF74807.1 230 sterol delta 8-isomerase [Rattus norvegicus]
GI:6681255 GenBank EDL83791.1 230 phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus]
GI:6681255 RefSeq NP_476478.1 230 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase [Rattus norvegicus]
GI:6681255 RefSeq XP_006256761.1 230 PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus]
GI:6681255 SwissProt Q9JJ46.3 230 RecName: Full=3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; AltName: Full=Cholestenol Delta-isomerase; AltName: Full=Delta(8)-Delta(7) sterol isomerase; Short=D8-D7 sterol isomerase; AltName: Full=Emopamil-binding protein; AltName: Full=Sterol 8-isomerase [Rattus norvegicus]