Gene/Proteome Database (LMPD)
LMPD ID
LMP000710
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Gene Symbol
Synonyms
AI255399; Pabp; Td; mSI
Alternate Names
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; tattered; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase
Chromosome
X
Map Location
X A1.1|X 3.7 cM
EC Number
5.3.3.5
Proteins
| 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | |
|---|---|
| Refseq ID | NP_031924 |
| Protein GI | 6681255 |
| UniProt ID | P70245 |
| mRNA ID | NM_007898 |
| Length | 230 |
| RefSeq Status | PROVISIONAL |
| MTTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN | |
Gene Information
Entrez Gene ID
Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | TAS:MGI | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000247 | IDA:MGI | F | C-8 sterol isomerase activity |
| GO:0047750 | IEA:UniProtKB-EC | F | cholestenol delta-isomerase activity |
| GO:0006695 | IEA:UniProtKB-UniPathway | P | cholesterol biosynthetic process |
| GO:0030097 | IMP:MGI | P | hemopoiesis |
| GO:0016126 | IMP:MGI | P | sterol biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893434 | Cholesterol biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007905 | Emopamil-binding protein |
UniProt Annotations
Entry Information
Gene Name
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
Protein Entry
EBP_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol. |
| Disease | Note=Defects in Ebp are a cause of 'Tattered' (Td) which is an X-linked, semidominant mouse mutation associated with prenatal male lethality. Heterozygous females are small and at 4 to 5 days of age develop patches of hyperkeratotic skin where no hair grows, resulting in a striping of the coat in adults. Craniofacial anomalies and twisted toes have also been observed in some affected females. |
| Function | Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers. |
| Miscellaneous | Binds to the phenylalkylamine calcium-ion antagonist emopamil, an anti-ischemic drug. |
| Pathway | Steroid biosynthesis; cholesterol biosynthesis. |
| Similarity | Belongs to the EBP family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000710 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6681255 | RefSeq | NP_031924 | 230 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase |
Identical Sequences to LMP000710 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6681255 | DBBJ | BAC25686.1 | 230 | unnamed protein product [Mus musculus] |
| GI:6681255 | EMBL | CAE83481.1 | 230 | unnamed protein product, partial [Mus musculus] |
| GI:6681255 | GenBank | EDL33961.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus] |
| GI:6681255 | GenBank | EDL33962.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus] |
| GI:6681255 | GenBank | EDL33963.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_a [Mus musculus] |
| GI:6681255 | GenBank | ADA21802.1 | 230 | Sequence 2 from patent US 7608421 |
Related Sequences to LMP000710 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6681255 | DBBJ | BAB28129.1 | 213 | unnamed protein product, partial [Mus musculus] |
| GI:6681255 | GenBank | AAF74807.1 | 230 | sterol delta 8-isomerase [Rattus norvegicus] |
| GI:6681255 | GenBank | EDL83791.1 | 230 | phenylalkylamine Ca2+ antagonist (emopamil) binding protein, isoform CRA_b [Rattus norvegicus] |
| GI:6681255 | RefSeq | NP_476478.1 | 230 | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase [Rattus norvegicus] |
| GI:6681255 | RefSeq | XP_006256761.1 | 230 | PREDICTED: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase isoform X1 [Rattus norvegicus] |
| GI:6681255 | SwissProt | Q9JJ46.3 | 230 | RecName: Full=3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; AltName: Full=Cholestenol Delta-isomerase; AltName: Full=Delta(8)-Delta(7) sterol isomerase; Short=D8-D7 sterol isomerase; AltName: Full=Emopamil-binding protein; AltName: Full=Sterol 8-isomerase [Rattus norvegicus] |