Gene/Proteome Database (LMPD)
LMPD ID
LMP000747
Gene ID
Species
Mus musculus (Mouse)
Gene Name
diazepam binding inhibitor
Gene Symbol
Synonyms
ACBD1; Acbp; EP; endozepine
Alternate Names
acyl-CoA-binding protein; acyl-CoA binding protein; diazepam-binding inhibitor; diazepam binding inhibitor, splice form 1b
Chromosome
1
Map Location
1|1 E2
Proteins
acyl-CoA-binding protein isoform 1 | |
---|---|
Refseq ID | NP_001033088 |
Protein GI | 83921595 |
UniProt ID | Q4VWZ5 |
mRNA ID | NM_001037999 |
Length | 135 |
RefSeq Status | VALIDATED |
MLWVWGQPGLFPQISRSSSGIRAQLIAWGAELFPLQICKTATHAGTARELPAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0000062 | IEA:InterPro | F | fatty-acyl-CoA binding |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0001942 | IMP:MGI | P | hair follicle development |
GO:0043588 | IMP:MGI | P | skin development |
GO:0006810 | IEA:UniProtKB-KW | P | transport |
GO:0006641 | IMP:MGI | P | triglyceride metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. |
Similarity | Belongs to the ACBP family. {ECO:0000305}. |
Similarity | Contains 1 ACB (acyl-CoA-binding) domain. {ECO:0000255|PROSITE-ProRule:PRU00573}. |
Subcellular Location | Endoplasmic reticulum {ECO:0000250}. Golgi apparatus {ECO:0000250}. Note=Golgi localization is dependent on ligand binding. {ECO:0000250}. |
Subunit | Monomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000747 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
83921595 | RefSeq | NP_001033088 | 135 | acyl-CoA-binding protein isoform 1 |
6681137 | RefSeq | NP_031856 | 87 | acyl-CoA-binding protein isoform 2 |
Identical Sequences to LMP000747 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6681137 | DBBJ | BAC25658.1 | 87 | unnamed protein product [Mus musculus] |
GI:6681137 | DBBJ | BAE28656.1 | 87 | unnamed protein product [Mus musculus] |
GI:83921595 | EMBL | CAJ00737.1 | 135 | diazepam binding inhibitor, splice form 1b [Mus musculus] |
GI:6681137 | GenBank | AAH28874.1 | 87 | Diazepam binding inhibitor [Mus musculus] |
GI:6681137 | GenBank | AAP97271.1 | 87 | benzodiazepine receptor ligand [Homo sapiens] |
GI:6681137 | GenBank | EDL39802.1 | 87 | mCG17804, isoform CRA_a [Mus musculus] |
GI:83921595 | GenBank | EDL39803.1 | 135 | mCG17804, isoform CRA_b [Mus musculus] |
GI:6681137 | GenBank | ABS83527.1 | 87 | diazepam binding inhibitor [Mus musculus] |
Related Sequences to LMP000747 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6681137 | DBBJ | BAE26340.1 | 87 | unnamed protein product [Mus musculus] |
GI:83921595 | EMBL | CAA43673.1 | 87 | diazepam-binding inhibitor [Mus musculus] |
GI:83921595 | GenBank | AAL56658.1 | 87 | diazepam binding inhibitor [Mus musculus] |
GI:83921595 | GenBank | AAH28874.1 | 87 | Diazepam binding inhibitor [Mus musculus] |
GI:6681137 | GenBank | AAH84717.1 | 87 | Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) [Rattus norvegicus] |
GI:83921595 | GenBank | EDL39802.1 | 87 | mCG17804, isoform CRA_a [Mus musculus] |
GI:83921595 | GenBank | ABS83527.1 | 87 | diazepam binding inhibitor [Mus musculus] |
GI:6681137 | GenBank | ERE73804.1 | 87 | acyl-CoA-binding protein [Cricetulus griseus] |
GI:83921595 | RefSeq | NP_031856.1 | 87 | acyl-CoA-binding protein isoform 2 [Mus musculus] |
GI:6681137 | RefSeq | XP_003499494.1 | 87 | PREDICTED: acyl-CoA-binding protein [Cricetulus griseus] |
GI:6681137 | RefSeq | XP_005348319.1 | 87 | PREDICTED: acyl-CoA-binding protein isoform X2 [Microtus ochrogaster] |
GI:6681137 | RefSeq | XP_007608376.1 | 87 | PREDICTED: acyl-CoA-binding protein [Cricetulus griseus] |