LIPID MAPS

LMPD ID

LMP000769

Gene ID

Species

Mus musculus (Mouse)

Gene Name

GPI-anchored HDL-binding protein 1

Gene Symbol

Synonyms

1110002J19Rik; GPI-HBP1

Chromosome

15

Map Location

15|15 E1

glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor
Refseq ID	NP_081006
Protein GI	58037121
UniProt ID	Q9D1N2
mRNA ID	NM_026730
Length	228
RefSeq Status	PROVISIONAL
MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQGSGAGYPSGWTKFGNIALLLSFFTCLWASGA
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2295 peptide sequence: MKALRAVLLILLLSGQPGSGWA mat_peptide: 23..198 product: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D1N2.1) calculated_mol_wt: 19184 peptide sequence: QEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQG

Entrez Gene ID

Gene Name

GPI-anchored HDL-binding protein 1

Gene Symbol

Species

Mus musculus

GO ID	Source	Type	Description
GO:0046658	IDA:MGI	C	anchored component of plasma membrane
GO:0016324	IDA:BHF-UCL	C	apical plasma membrane
GO:0016323	IDA:BHF-UCL	C	basolateral plasma membrane
GO:0009986	IDA:MGI	C	cell surface
GO:0009897	IDA:BHF-UCL	C	external side of plasma membrane
GO:0034364	IEA:UniProtKB-KW	C	high-density lipoprotein particle
GO:0035478	IMP:BHF-UCL	F	chylomicron binding
GO:0008035	IDA:MGI	F	high-density lipoprotein particle binding
GO:0035473	IPI:BHF-UCL	F	lipase binding
GO:0008289	IEA:UniProtKB-KW	F	lipid binding
GO:0071813	IMP:UniProtKB	F	lipoprotein particle binding
GO:0008320	IDA:BHF-UCL	F	protein transmembrane transporter activity
GO:0042632	IMP:BHF-UCL	P	cholesterol homeostasis
GO:0006886	IDA:BHF-UCL	P	intracellular protein transport
GO:0006869	IDA:MGI	P	lipid transport
GO:0090321	IMP:BHF-UCL	P	positive regulation of chylomicron remnant clearance
GO:0090319	IC:BHF-UCL	P	positive regulation of chylomicron remodeling
GO:0051006	IDA:BHF-UCL	P	positive regulation of lipoprotein lipase activity
GO:0017038	IDA:BHF-UCL	P	protein import
GO:0034394	IDA:BHF-UCL	P	protein localization to cell surface
GO:0050821	IDA:BHF-UCL	P	protein stabilization
GO:0071806	IDA:GOC	P	protein transmembrane transport
GO:0045056	IDA:BHF-UCL	P	transcytosis
GO:0070328	IMP:BHF-UCL	P	triglyceride homeostasis

Gene Name

GPI-anchored HDL-binding protein 1

Protein Entry

Q9D1N2_MOUSE

UniProt ID

Species

Mouse

Comment Type	Description
Disruption Phenotype	Mice manifest chylomicronemia, exhibiting a marked accumulation of chylomicrons in the plasma resulting in a milky plasma and plasma triglyceride levels as high as 5000 mg/dl. In Gpihbp1-deficient mice, LPL is mislocalized to the interstitial spaces surrounding myocytes and adipocytes.
Function	Plays a key role in the lipolytic processing of chylomicrons. Required for the transport of lipoprotein lipase LPL into the capillary lumen and across endothelial cells. {ECO:0000269\|PubMed:17403372, ECO:0000269\|PubMed:17620854, ECO:0000269\|PubMed:20620994}.
Ptm	Glycosylation of Asn-76 is critical for cell surface localization and the binding of chylomicrons and lipoprotein lipase.
Similarity	Contains 1 UPAR/Ly6 domain.
Subcellular Location	Apical cell membrane; Lipid-anchor, GPI- anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell membrane; Peripheral membrane protein; Extracellular side.
Subunit	Binds with high affinity to high-density lipoprotein (HDL). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5. {ECO:0000250\|UniProtKB:Q8IV16, ECO:0000269\|PubMed:12496272, ECO:0000269\|PubMed:17403372}.
Tissue Specificity	Highly expressed on the luminal surface of capillary endothelium in heart, adipose tissue and skeletal muscle. Not detected in capillaries of the brain. Expressed at lower levels in lung and liver. {ECO:0000269\|PubMed:12496272, ECO:0000269\|PubMed:17403372}.

Protein GI	Database	Accession	Length	Protein Name
58037121	RefSeq	NP_081006	228	glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor

Reference	Database	Accession	Length	Protein Name
GI:58037121	DBBJ	BAB22704.1	228	unnamed protein product [Mus musculus]
GI:58037121	DBBJ	BAC23061.1	228	high density lipoprotein binding protein 1 [Mus musculus]
GI:58037121	GenBank	AAH61225.1	228	GPI-anchored HDL-binding protein 1 [Mus musculus]
GI:58037121	GenBank	EDL29479.1	228	GPI-anchored HDL-binding protein 1, isoform CRA_b [Mus musculus]
GI:58037121	SwissProt	Q9D1N2.1	228	RecName: Full=Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; Short=GPI-HBP1; Short=GPI-anchored HDL-binding protein 1; AltName: Full=High density lipoprotein-binding protein 1; Flags: Precursor [Mus musculus]

Reference	Database	Accession	Length	Protein Name
GI:58037121	EMBL	CAC37739.1	236	unnamed protein product [Rattus norvegicus]
GI:58037121	GenBank	AAW06790.1	236	Sequence 6 from patent US 6800455
GI:58037121	GenBank	EDM16060.1	236	similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus]
GI:58037121	GenBank	ABS94084.1	236	Sequence 6 from patent US 7202344
GI:58037121	RefSeq	NP_001124019.1	236	glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor [Rattus norvegicus]
GI:58037121	RefSeq	XP_007614843.1	286	PREDICTED: glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform X2 [Cricetulus griseus]