Gene/Proteome Database (LMPD)

LMPD ID
LMP000769
Gene ID
68453
Species
Mus musculus (Mouse)
Gene Name
GPI-anchored HDL-binding protein 1
Gene Symbol
Gpihbp1
Synonyms
1110002J19Rik; GPI-HBP1
Chromosome
15
Map Location
15|15 E1

Proteins

glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor
Refseq ID NP_081006
Protein GI 58037121
UniProt ID Q9D1N2
mRNA ID NM_026730
Length 228
RefSeq Status PROVISIONAL
MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQGSGAGYPSGWTKFGNIALLLSFFTCLWASGA
sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2295 peptide sequence: MKALRAVLLILLLSGQPGSGWA mat_peptide: 23..198 product: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D1N2.1) calculated_mol_wt: 19184 peptide sequence: QEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQTCCQSTLCNIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKFSHPQVVKAAHPQSDGANLPKSGKANQPQG

Gene Information

Entrez Gene ID
68453
Gene Name
GPI-anchored HDL-binding protein 1
Gene Symbol
Gpihbp1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0046658 IDA:MGI C anchored component of plasma membrane
GO:0016324 IDA:BHF-UCL C apical plasma membrane
GO:0016323 IDA:BHF-UCL C basolateral plasma membrane
GO:0009986 IDA:MGI C cell surface
GO:0009897 IDA:BHF-UCL C external side of plasma membrane
GO:0034364 IEA:UniProtKB-KW C high-density lipoprotein particle
GO:0035478 IMP:BHF-UCL F chylomicron binding
GO:0008035 IDA:MGI F high-density lipoprotein particle binding
GO:0035473 IPI:BHF-UCL F lipase binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0071813 IMP:UniProtKB F lipoprotein particle binding
GO:0008320 IDA:BHF-UCL F protein transmembrane transporter activity
GO:0042632 IMP:BHF-UCL P cholesterol homeostasis
GO:0006886 IDA:BHF-UCL P intracellular protein transport
GO:0006869 IDA:MGI P lipid transport
GO:0090321 IMP:BHF-UCL P positive regulation of chylomicron remnant clearance
GO:0090319 IC:BHF-UCL P positive regulation of chylomicron remodeling
GO:0051006 IDA:BHF-UCL P positive regulation of lipoprotein lipase activity
GO:0017038 IDA:BHF-UCL P protein import
GO:0034394 IDA:BHF-UCL P protein localization to cell surface
GO:0050821 IDA:BHF-UCL P protein stabilization
GO:0071806 IDA:GOC P protein transmembrane transport
GO:0045056 IDA:BHF-UCL P transcytosis
GO:0070328 IMP:BHF-UCL P triglyceride homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR001526 CD59 antigen
IPR018363 CD59 antigen, conserved site
IPR016054 Ly-6 antigen / uPA receptor -like

UniProt Annotations

Entry Information

Gene Name
GPI-anchored HDL-binding protein 1
Protein Entry
Q9D1N2_MOUSE
UniProt ID
Q9D1N2
Species
Mouse

Comments

Comment Type Description
Disruption Phenotype Mice manifest chylomicronemia, exhibiting a marked accumulation of chylomicrons in the plasma resulting in a milky plasma and plasma triglyceride levels as high as 5000 mg/dl. In Gpihbp1-deficient mice, LPL is mislocalized to the interstitial spaces surrounding myocytes and adipocytes.
Function Plays a key role in the lipolytic processing of chylomicrons. Required for the transport of lipoprotein lipase LPL into the capillary lumen and across endothelial cells. {ECO:0000269|PubMed:17403372, ECO:0000269|PubMed:17620854, ECO:0000269|PubMed:20620994}.
Ptm Glycosylation of Asn-76 is critical for cell surface localization and the binding of chylomicrons and lipoprotein lipase.
Similarity Contains 1 UPAR/Ly6 domain.
Subcellular Location Apical cell membrane; Lipid-anchor, GPI- anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell membrane; Peripheral membrane protein; Extracellular side.
Subunit Binds with high affinity to high-density lipoprotein (HDL). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5. {ECO:0000250|UniProtKB:Q8IV16, ECO:0000269|PubMed:12496272, ECO:0000269|PubMed:17403372}.
Tissue Specificity Highly expressed on the luminal surface of capillary endothelium in heart, adipose tissue and skeletal muscle. Not detected in capillaries of the brain. Expressed at lower levels in lung and liver. {ECO:0000269|PubMed:12496272, ECO:0000269|PubMed:17403372}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000769 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58037121 RefSeq NP_081006 228 glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor

Identical Sequences to LMP000769 proteins

Reference Database Accession Length Protein Name
GI:58037121 DBBJ BAB22704.1 228 unnamed protein product [Mus musculus]
GI:58037121 DBBJ BAC23061.1 228 high density lipoprotein binding protein 1 [Mus musculus]
GI:58037121 GenBank AAH61225.1 228 GPI-anchored HDL-binding protein 1 [Mus musculus]
GI:58037121 GenBank EDL29479.1 228 GPI-anchored HDL-binding protein 1, isoform CRA_b [Mus musculus]
GI:58037121 SwissProt Q9D1N2.1 228 RecName: Full=Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; Short=GPI-HBP1; Short=GPI-anchored HDL-binding protein 1; AltName: Full=High density lipoprotein-binding protein 1; Flags: Precursor [Mus musculus]

Related Sequences to LMP000769 proteins

Reference Database Accession Length Protein Name
GI:58037121 EMBL CAC37739.1 236 unnamed protein product [Rattus norvegicus]
GI:58037121 GenBank AAW06790.1 236 Sequence 6 from patent US 6800455
GI:58037121 GenBank EDM16060.1 236 similar to high density lipoprotein-binding protein (predicted), isoform CRA_a [Rattus norvegicus]
GI:58037121 GenBank ABS94084.1 236 Sequence 6 from patent US 7202344
GI:58037121 RefSeq NP_001124019.1 236 glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor [Rattus norvegicus]
GI:58037121 RefSeq XP_007614843.1 286 PREDICTED: glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform X2 [Cricetulus griseus]