Gene/Proteome Database (LMPD)
LMPD ID
LMP000786
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sterol regulatory element binding transcription factor 1
Gene Symbol
Synonyms
ADD-1; ADD1; D630008H06; SREBP-1; SREBP-1a; SREBP-1c; SREBP1; SREBP1c; bHLHd1
Alternate Names
sterol regulatory element-binding protein 1; adipocyte determination- and differentiation-dependent factor 1
Chromosome
11
Map Location
11 B2|11
Proteins
| sterol regulatory element-binding protein 1 precursor | |
|---|---|
| Refseq ID | NP_035610 |
| Protein GI | 27753981 |
| UniProt ID | Q9WTN3 |
| mRNA ID | NM_011480 |
| Length | 1134 |
| RefSeq Status | PROVISIONAL |
| MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLALCVLAFLCLTCNPLASLFGWGILTPSDATGTHRSSGRSMLEAESRDGSNWTQWLLPPLVWLANGLLVLACLALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFPQAAQQLWLALQALGRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGQAGGLLRDRGLRKDARASARDAAVVYHKLHQLHAMGKYTGGHLAASNLALSALNLAECAGDAISMATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPLAMQWLCHPVGHRFFVDGDWAVHGAPPESLYSVAGNPVDPLAQVTRLFREHLLERALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAAGAPACSFSVSSSMAATTGPDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQDTERPLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTPTGSSIDKAMQLLLCDLLLVARTSLWQRQQSPASVQVAHGTSNGPQASALELRGFQHDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRRRAGSSGKGGTTAELEPRPTWREHTEALLLASCYLPPAFLSAPGQRMSMLAEAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS | |
| mat_peptide: 1..480 product: Processed sterol regulatory element-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WTN3.4) calculated_mol_wt: 49482 peptide sequence: MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL | |
Gene Information
Entrez Gene ID
Gene Name
sterol regulatory element binding transcription factor 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:BHF-UCL | C | membrane |
| GO:0005654 | TAS:Reactome | C | nucleoplasm |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0043234 | IEA:Ensembl | C | protein complex |
| GO:0003677 | IDA:UniProtKB | F | DNA binding |
| GO:0003682 | IDA:MGI | F | chromatin binding |
| GO:0019901 | IPI:UniProtKB | F | protein kinase binding |
| GO:0043565 | IDA:MGI | F | sequence-specific DNA binding |
| GO:0003700 | ISS:HGNC | F | sequence-specific DNA binding transcription factor activity |
| GO:0032810 | ISS:HGNC | F | sterol response element binding |
| GO:0044212 | IDA:MGI | F | transcription regulatory region DNA binding |
| GO:0007568 | IEA:Ensembl | P | aging |
| GO:0071398 | IEA:Ensembl | P | cellular response to fatty acid |
| GO:0009267 | IDA:HGNC | P | cellular response to starvation |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
| GO:0007623 | IEP:UniProtKB | P | circadian rhythm |
| GO:0008286 | IDA:MGI | P | insulin receptor signaling pathway |
| GO:0008610 | IDA:UniProtKB | P | lipid biosynthetic process |
| GO:0030324 | IEA:Ensembl | P | lung development |
| GO:0046676 | IMP:MGI | P | negative regulation of insulin secretion |
| GO:0000122 | IDA:MGI | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0045542 | IMP:MGI | P | positive regulation of cholesterol biosynthetic process |
| GO:0045723 | TAS:BHF-UCL | P | positive regulation of fatty acid biosynthetic process |
| GO:0031065 | IDA:MGI | P | positive regulation of histone deacetylation |
| GO:0045944 | IDA:MGI | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0045893 | IDA:BHF-UCL | P | positive regulation of transcription, DNA-templated |
| GO:0010867 | IDA:UniProtKB | P | positive regulation of triglyceride biosynthetic process |
| GO:0019217 | IMP:MGI | P | regulation of fatty acid metabolic process |
| GO:0003062 | IMP:MGI | P | regulation of heart rate by chemical signal |
| GO:0050796 | IMP:MGI | P | regulation of insulin secretion |
| GO:0006355 | IDA:UniProtKB | P | regulation of transcription, DNA-templated |
| GO:0051591 | IEA:Ensembl | P | response to cAMP |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0032094 | IEA:Ensembl | P | response to food |
| GO:0033762 | IEA:Ensembl | P | response to glucagon |
| GO:0009749 | IMP:MGI | P | response to glucose |
| GO:0032570 | IEA:Ensembl | P | response to progesterone |
| GO:0032526 | IEA:Ensembl | P | response to retinoic acid |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
UniProt Annotations
Entry Information
Gene Name
sterol regulatory element binding transcription factor 1
Protein Entry
SRBP1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=SREBP-1A; IsoId=Q9WTN3-1; Sequence=Displayed; Name=SREBP-1A-W42; IsoId=Q9WTN3-2; Sequence=VSP_002152; Name=SREBP-1C; IsoId=Q9WTN3-3; Sequence=VSP_002151; Name=SREBP-1C-W42; IsoId=Q9WTN3-4; Sequence=VSP_002151, VSP_002152; |
| Disruption Phenotype | Mice show high embryonic lethality around day 11 dpc. Surviving mice show a 2-3-fold increase in processed Srebpf2 protein in liver nuclei, 3-fold increase in cholesterol synthesis and 50% increase in cholesterol content of the liver. Mice lacking isoform SREBP-1C show a lack of up-regulation of several lipogenic enzymes in response to high insulin or LXR activation. Mice overexpressing processed isoform SREBP-1A in adipocytes show enlarged white and brown adipocytes, increased rate of fatty acid synthesis and secretion leading to a fatty liver. Mice overexpressing processed isoform SREBP-1C in adipocytes show inhibition of adipocyte differentiation leading to a syndrome similar to human lipodystrophy with loss of peripheral white adipose tissue, diabetes and fatty liver. {ECO:0000269|PubMed:11782483, ECO:0000269|PubMed:9329978}. |
| Function | Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway. Binds to the sterol regulatory element 1 (SRE- 1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC- 3'). Isoform SREBP-1A is much more active than isoform SREBP-1C in stimulating transcription from SRE-1-containing promoters. {ECO:0000269|PubMed:11782483, ECO:0000269|PubMed:12855691, ECO:0000269|PubMed:9329978, ECO:0000269|PubMed:9784493}. |
| Induction | Isoform SREBP-1C is expressed in a circadian manner in the liver with a peak at ZT16. {ECO:0000269|PubMed:19786558}. |
| Interaction | Q923E4:Sirt1; NbExp=2; IntAct=EBI-5273743, EBI-1802585; |
| Ptm | At low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane. Apoptosis triggers cleavage by the cysteine proteases caspase-3 and caspase-7. |
| Ptm | Phosphorylated by AMPK, leading to suppress protein processing and nuclear translocation, and repress target gene expression. Phosphorylation at Ser-389 by SIK1 represses activity possibly by inhibiting DNA-binding. {ECO:0000269|PubMed:19244231, ECO:0000269|PubMed:21459323}. |
| Similarity | Belongs to the SREBP family. {ECO:0000305}. |
| Similarity | Contains 1 bHLH (basic helix-loop-helix) domain. {ECO:0000255|PROSITE-ProRule:PRU00981}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Golgi apparatus membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Cytoplasmic vesicle, COPII-coated vesicle membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Note=Moves from the endoplasmic reticulum to the Golgi in the absence of sterols. |
| Subcellular Location | Processed sterol regulatory element-binding protein 1: Nucleus. |
| Subunit | Forms a tight complex with SCAP in the ER membrane. Efficient DNA binding of the soluble transcription factor fragment requires dimerization with another bHLH protein. Interacts with LMNA. {ECO:0000269|PubMed:11929849}. |
| Tissue Specificity | Isoform SREBP-1C predominates in liver, adrenal gland, brain and adipose tissue, whereas isoform SREBP-1A predominates in spleen. Isoform SREBP-1A and isoform SREBP-1C are found in kidney, thymus, testis, muscle, jejunum, and ileum. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000786 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 27753981 | RefSeq | NP_035610 | 1134 | sterol regulatory element-binding protein 1 precursor |
Identical Sequences to LMP000786 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27753981 | DBBJ | BAC35068.1 | 1134 | unnamed protein product [Mus musculus] |
| GI:27753981 | DBBJ | BAE41256.1 | 1134 | unnamed protein product [Mus musculus] |
| GI:27753981 | GenBank | AAH56922.1 | 1134 | Sterol regulatory element binding transcription factor 1 [Mus musculus] |
| GI:27753981 | GenBank | EDL26615.1 | 1134 | sterol regulatory element binding factor 1, isoform CRA_b [Mus musculus] |
| GI:27753981 | SwissProt | Q9WTN3.4 | 1134 | RecName: Full=Sterol regulatory element-binding protein 1; Short=SREBP-1; AltName: Full=Sterol regulatory element-binding transcription factor 1; Contains: RecName: Full=Processed sterol regulatory element-binding protein 1 [Mus musculus] |
Related Sequences to LMP000786 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27753981 | DBBJ | BAE29268.1 | 1134 | unnamed protein product [Mus musculus] |
| GI:27753981 | GenBank | EDL26614.1 | 1110 | sterol regulatory element binding factor 1, isoform CRA_a [Mus musculus] |
| GI:27753981 | RefSeq | XP_006532776.1 | 1173 | PREDICTED: sterol regulatory element-binding protein 1 isoform X1 [Mus musculus] |
| GI:27753981 | RefSeq | XP_006532777.1 | 1111 | PREDICTED: sterol regulatory element-binding protein 1 isoform X2 [Mus musculus] |
| GI:27753981 | RefSeq | XP_006532778.1 | 1110 | PREDICTED: sterol regulatory element-binding protein 1 isoform X3 [Mus musculus] |
| GI:27753981 | RefSeq | XP_006532780.1 | 1103 | PREDICTED: sterol regulatory element-binding protein 1 isoform X5 [Mus musculus] |