Gene/Proteome Database (LMPD)

LMPD ID
LMP000786
Gene ID
20787
Species
Mus musculus (Mouse)
Gene Name
sterol regulatory element binding transcription factor 1
Gene Symbol
Srebf1
Synonyms
ADD-1; ADD1; D630008H06; SREBP-1; SREBP-1a; SREBP-1c; SREBP1; SREBP1c; bHLHd1
Alternate Names
sterol regulatory element-binding protein 1; adipocyte determination- and differentiation-dependent factor 1
Chromosome
11
Map Location
11 B2|11

Proteins

sterol regulatory element-binding protein 1 precursor
Refseq ID NP_035610
Protein GI 27753981
UniProt ID Q9WTN3
mRNA ID NM_011480
Length 1134
RefSeq Status PROVISIONAL
MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLALCVLAFLCLTCNPLASLFGWGILTPSDATGTHRSSGRSMLEAESRDGSNWTQWLLPPLVWLANGLLVLACLALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFPQAAQQLWLALQALGRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGQAGGLLRDRGLRKDARASARDAAVVYHKLHQLHAMGKYTGGHLAASNLALSALNLAECAGDAISMATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPLAMQWLCHPVGHRFFVDGDWAVHGAPPESLYSVAGNPVDPLAQVTRLFREHLLERALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAAGAPACSFSVSSSMAATTGPDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQDTERPLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTPTGSSIDKAMQLLLCDLLLVARTSLWQRQQSPASVQVAHGTSNGPQASALELRGFQHDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRRRAGSSGKGGTTAELEPRPTWREHTEALLLASCYLPPAFLSAPGQRMSMLAEAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS
mat_peptide: 1..480 product: Processed sterol regulatory element-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WTN3.4) calculated_mol_wt: 49482 peptide sequence: MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL

Gene Information

Entrez Gene ID
20787
Gene Name
sterol regulatory element binding transcription factor 1
Gene Symbol
Srebf1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:BHF-UCL C membrane
GO:0005654 TAS:Reactome C nucleoplasm
GO:0005634 IDA:UniProtKB C nucleus
GO:0043234 IEA:Ensembl C protein complex
GO:0003677 IDA:UniProtKB F DNA binding
GO:0003682 IDA:MGI F chromatin binding
GO:0019901 IPI:UniProtKB F protein kinase binding
GO:0043565 IDA:MGI F sequence-specific DNA binding
GO:0003700 ISS:HGNC F sequence-specific DNA binding transcription factor activity
GO:0032810 ISS:HGNC F sterol response element binding
GO:0044212 IDA:MGI F transcription regulatory region DNA binding
GO:0007568 IEA:Ensembl P aging
GO:0071398 IEA:Ensembl P cellular response to fatty acid
GO:0009267 IDA:HGNC P cellular response to starvation
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process
GO:0007623 IEP:UniProtKB P circadian rhythm
GO:0008286 IDA:MGI P insulin receptor signaling pathway
GO:0008610 IDA:UniProtKB P lipid biosynthetic process
GO:0030324 IEA:Ensembl P lung development
GO:0046676 IMP:MGI P negative regulation of insulin secretion
GO:0000122 IDA:MGI P negative regulation of transcription from RNA polymerase II promoter
GO:0045542 IMP:MGI P positive regulation of cholesterol biosynthetic process
GO:0045723 TAS:BHF-UCL P positive regulation of fatty acid biosynthetic process
GO:0031065 IDA:MGI P positive regulation of histone deacetylation
GO:0045944 IDA:MGI P positive regulation of transcription from RNA polymerase II promoter
GO:0045893 IDA:BHF-UCL P positive regulation of transcription, DNA-templated
GO:0010867 IDA:UniProtKB P positive regulation of triglyceride biosynthetic process
GO:0019217 IMP:MGI P regulation of fatty acid metabolic process
GO:0003062 IMP:MGI P regulation of heart rate by chemical signal
GO:0050796 IMP:MGI P regulation of insulin secretion
GO:0006355 IDA:UniProtKB P regulation of transcription, DNA-templated
GO:0051591 IEA:Ensembl P response to cAMP
GO:0042493 IEA:Ensembl P response to drug
GO:0032094 IEA:Ensembl P response to food
GO:0033762 IEA:Ensembl P response to glucagon
GO:0009749 IMP:MGI P response to glucose
GO:0032570 IEA:Ensembl P response to progesterone
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

KEGG Pathway Links

KEGG Pathway ID Description
mmu04152 AMPK signaling pathway
mmu04910 Insulin signaling pathway
mmu04932 Non-alcoholic fatty liver disease (NAFLD)

Domain Information

InterPro Annotations

Accession Description
IPR011598 Myc-type, basic helix-loop-helix (bHLH) domain

UniProt Annotations

Entry Information

Gene Name
sterol regulatory element binding transcription factor 1
Protein Entry
SRBP1_MOUSE
UniProt ID
Q9WTN3
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=SREBP-1A; IsoId=Q9WTN3-1; Sequence=Displayed; Name=SREBP-1A-W42; IsoId=Q9WTN3-2; Sequence=VSP_002152; Name=SREBP-1C; IsoId=Q9WTN3-3; Sequence=VSP_002151; Name=SREBP-1C-W42; IsoId=Q9WTN3-4; Sequence=VSP_002151, VSP_002152;
Disruption Phenotype Mice show high embryonic lethality around day 11 dpc. Surviving mice show a 2-3-fold increase in processed Srebpf2 protein in liver nuclei, 3-fold increase in cholesterol synthesis and 50% increase in cholesterol content of the liver. Mice lacking isoform SREBP-1C show a lack of up-regulation of several lipogenic enzymes in response to high insulin or LXR activation. Mice overexpressing processed isoform SREBP-1A in adipocytes show enlarged white and brown adipocytes, increased rate of fatty acid synthesis and secretion leading to a fatty liver. Mice overexpressing processed isoform SREBP-1C in adipocytes show inhibition of adipocyte differentiation leading to a syndrome similar to human lipodystrophy with loss of peripheral white adipose tissue, diabetes and fatty liver. {ECO:0000269|PubMed:11782483, ECO:0000269|PubMed:9329978}.
Function Transcriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the fatty acid and to a lesser degree the cholesterol synthesis pathway. Binds to the sterol regulatory element 1 (SRE- 1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC- 3'). Isoform SREBP-1A is much more active than isoform SREBP-1C in stimulating transcription from SRE-1-containing promoters. {ECO:0000269|PubMed:11782483, ECO:0000269|PubMed:12855691, ECO:0000269|PubMed:9329978, ECO:0000269|PubMed:9784493}.
Induction Isoform SREBP-1C is expressed in a circadian manner in the liver with a peak at ZT16. {ECO:0000269|PubMed:19786558}.
Interaction Q923E4:Sirt1; NbExp=2; IntAct=EBI-5273743, EBI-1802585;
Ptm At low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane. Apoptosis triggers cleavage by the cysteine proteases caspase-3 and caspase-7.
Ptm Phosphorylated by AMPK, leading to suppress protein processing and nuclear translocation, and repress target gene expression. Phosphorylation at Ser-389 by SIK1 represses activity possibly by inhibiting DNA-binding. {ECO:0000269|PubMed:19244231, ECO:0000269|PubMed:21459323}.
Similarity Belongs to the SREBP family. {ECO:0000305}.
Similarity Contains 1 bHLH (basic helix-loop-helix) domain. {ECO:0000255|PROSITE-ProRule:PRU00981}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Golgi apparatus membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Cytoplasmic vesicle, COPII-coated vesicle membrane {ECO:0000269|PubMed:21459323}; Multi-pass membrane protein {ECO:0000269|PubMed:21459323}. Note=Moves from the endoplasmic reticulum to the Golgi in the absence of sterols.
Subcellular Location Processed sterol regulatory element-binding protein 1: Nucleus.
Subunit Forms a tight complex with SCAP in the ER membrane. Efficient DNA binding of the soluble transcription factor fragment requires dimerization with another bHLH protein. Interacts with LMNA. {ECO:0000269|PubMed:11929849}.
Tissue Specificity Isoform SREBP-1C predominates in liver, adrenal gland, brain and adipose tissue, whereas isoform SREBP-1A predominates in spleen. Isoform SREBP-1A and isoform SREBP-1C are found in kidney, thymus, testis, muscle, jejunum, and ileum.

Identical and Related Proteins

Unique RefSeq proteins for LMP000786 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
27753981 RefSeq NP_035610 1134 sterol regulatory element-binding protein 1 precursor

Identical Sequences to LMP000786 proteins

Reference Database Accession Length Protein Name
GI:27753981 DBBJ BAC35068.1 1134 unnamed protein product [Mus musculus]
GI:27753981 DBBJ BAE41256.1 1134 unnamed protein product [Mus musculus]
GI:27753981 GenBank AAH56922.1 1134 Sterol regulatory element binding transcription factor 1 [Mus musculus]
GI:27753981 GenBank EDL26615.1 1134 sterol regulatory element binding factor 1, isoform CRA_b [Mus musculus]
GI:27753981 SwissProt Q9WTN3.4 1134 RecName: Full=Sterol regulatory element-binding protein 1; Short=SREBP-1; AltName: Full=Sterol regulatory element-binding transcription factor 1; Contains: RecName: Full=Processed sterol regulatory element-binding protein 1 [Mus musculus]

Related Sequences to LMP000786 proteins

Reference Database Accession Length Protein Name
GI:27753981 DBBJ BAE29268.1 1134 unnamed protein product [Mus musculus]
GI:27753981 GenBank EDL26614.1 1110 sterol regulatory element binding factor 1, isoform CRA_a [Mus musculus]
GI:27753981 RefSeq XP_006532776.1 1173 PREDICTED: sterol regulatory element-binding protein 1 isoform X1 [Mus musculus]
GI:27753981 RefSeq XP_006532777.1 1111 PREDICTED: sterol regulatory element-binding protein 1 isoform X2 [Mus musculus]
GI:27753981 RefSeq XP_006532778.1 1110 PREDICTED: sterol regulatory element-binding protein 1 isoform X3 [Mus musculus]
GI:27753981 RefSeq XP_006532780.1 1103 PREDICTED: sterol regulatory element-binding protein 1 isoform X5 [Mus musculus]