Gene/Proteome Database (LMPD)

LMPD ID
LMP000800
Gene ID
54677
Species
Homo sapiens (Human)
Gene Name
carnitine O-octanoyltransferase
Gene Symbol
CROT
Synonyms
COT
Alternate Names
peroxisomal carnitine O-octanoyltransferase; peroxisomal carnitine acyltransferase
Chromosome
7
Map Location
7q21.1
EC Number
2.3.1.137
Summary
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jan 2009]
Orthologs
View orthologs and multiple alignments for CROT

Proteins

peroxisomal carnitine O-octanoyltransferase isoform 1
Refseq ID NP_001137407
Protein GI 221316602
UniProt ID Q9UKG9
mRNA ID NM_001143935
Length 640
RefSeq Status REVIEWED
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVTRTCYQIRGLDPDAKRGFLDLTREGIQVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLRKEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGCLVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMEDSSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFIQLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKHNKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHL
peroxisomal carnitine O-octanoyltransferase isoform 2
Refseq ID NP_066974
Protein GI 31542325
UniProt ID Q9UKG9
mRNA ID NM_021151
Length 612
RefSeq Status REVIEWED
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLRKEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGCLVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMEDSSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFIQLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKHNKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHL
peroxisomal carnitine O-octanoyltransferase isoform 3
Refseq ID NP_001230674
Protein GI 344217750
UniProt ID Q9UKG9
mRNA ID NM_001243745
Length 87
RefSeq Status REVIEWED
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE

Gene Information

Entrez Gene ID
54677
Gene Name
carnitine O-octanoyltransferase
Gene Symbol
CROT
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043231 IDA:HPA C intracellular membrane-bounded organelle
GO:0005739 IEA:Ensembl C mitochondrion
GO:0005782 TAS:Reactome C peroxisomal matrix
GO:0005777 IDA:UniProtKB C peroxisome
GO:0008458 IDA:UniProtKB F carnitine O-octanoyltransferase activity
GO:0005102 IPI:UniProtKB F receptor binding
GO:0009437 ISS:UniProtKB P carnitine metabolic process
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0015936 ISS:UniProtKB P coenzyme A metabolic process
GO:0006635 IDA:UniProtKB P fatty acid beta-oxidation
GO:0033540 TAS:Reactome P fatty acid beta-oxidation using acyl-CoA oxidase
GO:0006631 IMP:UniProtKB P fatty acid metabolic process
GO:0015908 IEA:Ensembl P fatty acid transport
GO:0006091 IDA:UniProtKB P generation of precursor metabolites and energy
GO:0051791 IDA:UniProtKB P medium-chain fatty acid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04146 Peroxisome
ko04146 Peroxisome

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_17017 Beta-oxidation of pristanoyl-CoA
REACT_16957 Peroxisomal lipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR000542 Acyltransferase ChoActase/COT/CPT

UniProt Annotations

Entry Information

Gene Name
carnitine O-octanoyltransferase
Protein Entry
OCTC_HUMAN
UniProt ID
Q9UKG9
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9UKG9-1; Sequence=Displayed; Name=2; IsoId=Q9UKG9-2; Sequence=VSP_045213, VSP_045214; Name=3; IsoId=Q9UKG9-3; Sequence=VSP_046953; Note=No experimental confirmation available. Gene prediction based on cDNA data.;
Catalytic Activity Octanoyl-CoA + L-carnitine = CoA + L- octanoylcarnitine.
Function Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl- CoA, to its corresponding carnitine ester.
Pathway Lipid metabolism; fatty acid beta-oxidation.
Similarity Belongs to the carnitine/choline acetyltransferase family.
Subcellular Location Peroxisome .
Subunit Monomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP000800 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
221316602 RefSeq NP_001137407 640 peroxisomal carnitine O-octanoyltransferase isoform 1
31542325 RefSeq NP_066974 612 peroxisomal carnitine O-octanoyltransferase isoform 2
344217750 RefSeq NP_001230674 87 peroxisomal carnitine O-octanoyltransferase isoform 3

Identical Sequences to LMP000800 proteins

Reference Database Accession Length Protein Name
GI:31542325 GenBank AAH39004.1 612 Carnitine O-octanoyltransferase [Homo sapiens]
GI:344217750 GenBank AAH51874.1 87 CROT protein [Homo sapiens]
GI:31542325 GenBank EAL24177.1 612 carnitine O-octanoyltransferase [Homo sapiens]
GI:31542325 GenBank EAW76954.1 612 carnitine O-octanoyltransferase [Homo sapiens]
GI:344217750 GenBank AIC58375.1 87 CROT, partial [synthetic construct]
GI:31542325 SwissProt Q9UKG9.2 612 RecName: Full=Peroxisomal carnitine O-octanoyltransferase; Short=COT [Homo sapiens]

Related Sequences to LMP000800 proteins

Reference Database Accession Length Protein Name
GI:344217750 GenBank AAD41654.1 612 carnitine octanoyltransferase [Homo sapiens]
GI:31542325 GenBank AAD41654.1 612 carnitine octanoyltransferase [Homo sapiens]
GI:31542325 GenBank AAF03234.1 612 peroxisomal carnitine octanoyltransferase [Homo sapiens]
GI:344217750 GenBank AAF03234.1 612 peroxisomal carnitine octanoyltransferase [Homo sapiens]
GI:344217750 GenBank AAH39004.1 612 Carnitine O-octanoyltransferase [Homo sapiens]
GI:221316602 GenBank AAH39004.1 612 Carnitine O-octanoyltransferase [Homo sapiens]
GI:344217750 GenBank EAL24177.1 612 carnitine O-octanoyltransferase [Homo sapiens]
GI:344217750 GenBank EAW76954.1 612 carnitine O-octanoyltransferase [Homo sapiens]
GI:31542325 GenBank ACM81822.1 656 Sequence 7320 from patent US 6812339
GI:31542325 GenBank JAA07694.1 612 carnitine O-octanoyltransferase [Pan troglodytes]
GI:31542325 GenBank JAA21552.1 612 carnitine O-octanoyltransferase [Pan troglodytes]
GI:31542325 GenBank JAA23183.1 612 carnitine O-octanoyltransferase [Pan troglodytes]
GI:344217750 RefSeq NP_066974.2 612 peroxisomal carnitine O-octanoyltransferase isoform 2 [Homo sapiens]
GI:221316602 RefSeq NP_066974.2 612 peroxisomal carnitine O-octanoyltransferase isoform 2 [Homo sapiens]
GI:221316602 RefSeq XP_001106063.2 640 PREDICTED: peroxisomal carnitine O-octanoyltransferase isoform 2 [Macaca mulatta]
GI:221316602 RefSeq XP_003252382.1 640 PREDICTED: peroxisomal carnitine O-octanoyltransferase isoform 2 [Nomascus leucogenys]
GI:221316602 RefSeq XP_004045736.1 640 PREDICTED: peroxisomal carnitine O-octanoyltransferase isoform 2 [Gorilla gorilla gorilla]
GI:221316602 SwissProt Q9UKG9.2 612 RecName: Full=Peroxisomal carnitine O-octanoyltransferase; Short=COT [Homo sapiens]