Gene/Proteome Database (LMPD)
LMPD ID
LMP000801
Gene ID
Species
Homo sapiens (Human)
Gene Name
ELOVL fatty acid elongase 2
Gene Symbol
Synonyms
SSC2
Alternate Names
elongation of very long chain fatty acids protein 2; ELOVL FA elongase 2; 3-keto acyl-CoA synthase ELOVL2; very-long-chain 3-oxoacyl-CoA synthase 2; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
Chromosome
6
Map Location
6p24.2
EC Number
2.3.1.199
Proteins
| elongation of very long chain fatty acids protein 2 | |
|---|---|
| Refseq ID | NP_060240 |
| Protein GI | 157388945 |
| UniProt ID | Q9NXB9 |
| mRNA ID | NM_017770 |
| Length | 296 |
| RefSeq Status | VALIDATED |
| MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009922 | IDA:UniProtKB | F | fatty acid elongase activity |
| GO:0036109 | TAS:Reactome | P | alpha-linolenic acid metabolic process |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0034626 | IDA:UniProtKB | P | fatty acid elongation, polyunsaturated fatty acid |
| GO:0043651 | TAS:Reactome | P | linoleic acid metabolic process |
| GO:0035338 | TAS:Reactome | P | long-chain fatty-acyl-CoA biosynthetic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
| GO:0033559 | TAS:Reactome | P | unsaturated fatty acid metabolic process |
| GO:0042761 | IDA:UniProtKB | P | very long-chain fatty acid biosynthetic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121147 | alpha-linolenic acid (ALA) metabolism |
| REACT_121100 | Linoleic acid (LA) metabolism |
| REACT_380 | Synthesis of very long-chain fatty acyl-CoAs |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Domain | The di-lysine motif may confer endoplasmic reticulum localization. |
| Function | Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA). Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. {ECO |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. {ECO |
| Similarity | Belongs to the ELO family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Liver and testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000801 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157388945 | RefSeq | NP_060240 | 296 | elongation of very long chain fatty acids protein 2 |
Identical Sequences to LMP000801 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157388945 | GenBank | EAW55292.1 | 296 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2, isoform CRA_b [Homo sapiens] |
| GI:157388945 | GenBank | ABY03476.1 | 296 | Sequence 61 from patent US 7297523 |
| GI:157388945 | GenBank | AFL64475.1 | 296 | Sequence 22 from patent US 8188335 |
| GI:157388945 | GenBank | JAA05018.1 | 296 | elongation of very long chain fatty acids-like 2 [Pan troglodytes] |
| GI:157388945 | RefSeq | XP_002816468.1 | 296 | PREDICTED: elongation of very long chain fatty acids protein 2 [Pongo abelii] |
| GI:157388945 | SwissProt | Q9NXB9.2 | 296 | RecName: Full=Elongation of very long chain fatty acids protein 2; AltName: Full=3-keto acyl-CoA synthase ELOVL2; AltName: Full=ELOVL fatty acid elongase 2; Short=ELOVL FA elongase 2; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 2 [Homo sapiens] |
Related Sequences to LMP000801 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157388945 | GenBank | AAH60809.1 | 296 | Elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 [Homo sapiens] |
| GI:157388945 | GenBank | ADQ33026.1 | 296 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2, partial [synthetic construct] |
| GI:157388945 | GenBank | AIC56586.1 | 296 | ELOVL2, partial [synthetic construct] |
| GI:157388945 | RefSeq | XP_004043329.1 | 308 | PREDICTED: elongation of very long chain fatty acids protein 2 [Gorilla gorilla gorilla] |
| GI:157388945 | RefSeq | XP_008951140.1 | 326 | PREDICTED: elongation of very long chain fatty acids protein 2 isoform X1 [Pan paniscus] |
| GI:157388945 | RefSeq | XP_009448770.1 | 326 | PREDICTED: elongation of very long chain fatty acids protein 2 isoform X1 [Pan troglodytes] |