Gene/Proteome Database (LMPD)
Proteins
| ubiquinone biosynthesis protein COQ7 homolog | |
|---|---|
| Refseq ID | NP_034070 |
| Protein GI | 20587962 |
| UniProt ID | P97478 |
| mRNA ID | NM_009940 |
| Length | 217 |
| RefSeq Status | PROVISIONAL |
| MSAAGAIAAASVGRLRTGVRRPFSEYGRGLIIRCHSSGMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF | |
| transit_peptide: 1..34 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (P97478.3) calculated_mol_wt: 3564 peptide sequence: MSAAGAIAAASVGRLRTGVRRPFSEYGRGLIIRC mat_peptide: 35..217 product: Ubiquinone biosynthesis protein COQ7 homolog experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P97478.3) calculated_mol_wt: 20496 peptide sequence: HSSGMTLDNINRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0001306 | IMP:MGI | P | age-dependent response to oxidative stress |
| GO:0034599 | IMP:MGI | P | cellular response to oxidative stress |
| GO:0008340 | IMP:MGI | P | determination of adult lifespan |
| GO:0001701 | IMP:MGI | P | in utero embryonic development |
| GO:0042775 | IMP:MGI | P | mitochondrial ATP synthesis coupled electron transport |
| GO:0070584 | IMP:MGI | P | mitochondrion morphogenesis |
| GO:0001841 | IMP:MGI | P | neural tube formation |
| GO:0022008 | IMP:MGI | P | neurogenesis |
| GO:0022904 | IMP:MGI | P | respiratory electron transport chain |
| GO:0006979 | IMP:MGI | P | response to oxidative stress |
| GO:0006744 | IMP:MGI | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu01100 | Metabolic pathways |
| mmu00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5894069 | Ubiquinol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 2 iron ions per subunit. {ECO:0000250}; |
| Disruption Phenotype | Mice lacking Coq7 start to die after E8. Heterozygous mutant reveal that the reduction of Coq7 levels in these animals profoundly alters their mitochondrial function despite the fact that ubiquinone production is unaffected. The mitochondria of young mutants heterozygous are dysfunctional, exhibiting reduced energy metabolism and a substantial increase in oxidative stress. {ECO:0000269|PubMed:19478076}. |
| Function | Involved in lifespan determination in ubiquinone- independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator. {ECO:0000269|PubMed:19478076}. |
| Miscellaneous | In life-span analysis, transgenic expression reverted the extended life span of clk-1 to the comparable level with wild-type control. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the COQ7 family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion inner membrane {ECO:0000269|PubMed:11387338}; Peripheral membrane protein {ECO:0000269|PubMed:11387338}; Matrix side {ECO:0000269|PubMed:11387338}. Note=Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane. |
| Subunit | Interacts with ADCK4 and COQ6. {ECO:0000250}. |
| Tissue Specificity | Highly expressed in tissues with high energy demand such as heart, muscle, liver, and kidney. {ECO:0000269|PubMed:11511092}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000820 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20587962 | RefSeq | NP_034070 | 217 | ubiquinone biosynthesis protein COQ7 homolog |
Identical Sequences to LMP000820 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20587962 | GenBank | AAC31572.1 | 217 | CLK-1 [Mus musculus] |
| GI:20587962 | GenBank | AAD43649.1 | 217 | COQ7 protein [Mus musculus] |
| GI:20587962 | GenBank | AAH38681.1 | 217 | Demethyl-Q 7 [Mus musculus] |
| GI:20587962 | GenBank | ABL29746.1 | 217 | Sequence 15 from patent US 7132274 |
| GI:20587962 | GenBank | EDL17129.1 | 217 | demethyl-Q 7, isoform CRA_a [Mus musculus] |
| GI:20587962 | SwissProt | P97478.3 | 217 | RecName: Full=Ubiquinone biosynthesis protein COQ7 homolog; AltName: Full=Coenzyme Q biosynthesis protein 7 homolog; AltName: Full=Timing protein clk-1 homolog; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000820 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20587962 | DBBJ | BAE34481.1 | 337 | unnamed protein product [Mus musculus] |
| GI:20587962 | RefSeq | XP_005075678.1 | 216 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Mesocricetus auratus] |
| GI:20587962 | RefSeq | XP_006507359.1 | 337 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Mus musculus] |
| GI:20587962 | RefSeq | XP_006507360.1 | 220 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X2 [Mus musculus] |
| GI:20587962 | RefSeq | XP_006985750.1 | 217 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Peromyscus maniculatus bairdii] |
| GI:20587962 | RefSeq | XP_007632827.1 | 216 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X2 [Cricetulus griseus] |