Gene/Proteome Database (LMPD)

LMPD ID
LMP000822
Gene ID
66102
Species
Mus musculus (Mouse)
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Cxcl16
Synonyms
0910001K24Rik; AV290116; BB024863; CXCL16v1; CXCL16v2; SR-PSOX; Zmynd15; b2b498Clo
Alternate Names
C-X-C motif chemokine 16; SR-PSOX/CXCL16; Mutant line 498; Cxc chemokine ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16; zinc finger, MYND-type containing 15; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein
Chromosome
11
Map Location
11|11 B4

Proteins

C-X-C motif chemokine 16 precursor
Refseq ID NP_075647
Protein GI 83745124
UniProt ID Q8BSU2
mRNA ID NM_023158
Length 246
RefSeq Status PROVISIONAL
MRRGFGPLSLAFFLFLLALLTLPGDGNQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVPVLSLLAIVFFLTAAMAYVLCNRRATQQNSAGLQLWYTPVEPRP
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2823 peptide sequence: MRRGFGPLSLAFFLFLLALLTLPGDG mat_peptide: 27..246 product: C-X-C motif chemokine 16 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8BSU2.2) calculated_mol_wt: 24091 peptide sequence: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVPVLSLLAIVFFLTAAMAYVLCNRRATQQNSAGLQLWYTPVEPRP

Gene Information

Entrez Gene ID
66102
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Cxcl16
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IEA:UniProtKB-KW C extracellular space
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008009 IDA:MGI F chemokine activity
GO:0005041 IDA:MGI F low-density lipoprotein receptor activity
GO:0005044 IDA:MGI F scavenger receptor activity
GO:0048247 IEA:InterPro P lymphocyte chemotaxis
GO:0030307 IEA:InterPro P positive regulation of cell growth
GO:0030335 IEA:InterPro P positive regulation of cell migration
GO:0034341 IEA:InterPro P response to interferon-gamma
GO:0034612 IEA:InterPro P response to tumor necrosis factor

KEGG Pathway Links

KEGG Pathway ID Description
mmu04062 Chemokine signaling pathway
mmu04060 Cytokine-cytokine receptor interaction

Domain Information

InterPro Annotations

Accession Description
IPR026296 CXC chemokine 16

UniProt Annotations

Entry Information

Gene Name
chemokine (C-X-C motif) ligand 16
Protein Entry
CXL16_MOUSE
UniProt ID
Q8BSU2
Species
Mouse

Comments

Comment Type Description
Function Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. Also acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. {ECO:0000269|PubMed:11060282}.
Ptm Glycosylated. {ECO:0000250}.
Similarity Belongs to the intercrine alpha (chemokine CxC) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}.
Tissue Specificity Widely expressed. Not detected in purified B- and T-cells. {ECO:0000269|PubMed:11017100, ECO:0000269|PubMed:20675388}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000822 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
83745124 RefSeq NP_075647 246 C-X-C motif chemokine 16 precursor

Identical Sequences to LMP000822 proteins

Reference Database Accession Length Protein Name
GI:83745124 DBBJ BAE30949.1 246 unnamed protein product [Mus musculus]
GI:83745124 DBBJ BAE31302.1 246 unnamed protein product [Mus musculus]
GI:83745124 EMBL CAM28189.1 246 chemokine (C-X-C motif) ligand 16 [Mus musculus]
GI:83745124 EMBL CDM22052.1 246 unnamed protein product [Mus musculus]
GI:83745124 GenBank EDL12565.1 246 chemokine (C-X-C motif) ligand 16, isoform CRA_a [Mus musculus]
GI:83745124 GenBank EDL12566.1 246 chemokine (C-X-C motif) ligand 16, isoform CRA_a [Mus musculus]

Related Sequences to LMP000822 proteins

Reference Database Accession Length Protein Name
GI:83745124 DBBJ BAC27000.1 233 unnamed protein product, partial [Mus musculus]
GI:83745124 DBBJ BAE29391.1 199 unnamed protein product, partial [Mus musculus]
GI:83745124 EMBL CAM28188.1 233 chemokine (C-X-C motif) ligand 16, partial [Mus musculus]
GI:83745124 GenBank AAH19961.1 246 Chemokine (C-X-C motif) ligand 16 [Mus musculus]
GI:83745124 GenBank EDM05009.1 247 similar to chemokine (C-X-C motif) ligand 16, isoform CRA_b [Rattus norvegicus]
GI:83745124 SwissProt Q6AXU5.1 247 RecName: Full=C-X-C motif chemokine 16; AltName: Full=Small-inducible cytokine B16; AltName: Full=Transmembrane chemokine CXCL16; Flags: Precursor [Rattus norvegicus]