Gene/Proteome Database (LMPD)

LMPD ID
LMP000833
Gene ID
23980
Species
Mus musculus (Mouse)
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Pebp1
Synonyms
HCNP; Pbp; Pbp1; Pbpr; Rkip
Alternate Names
phosphatidylethanolamine-binding protein 1; HCNPpp; PEBP-1; Raf-1 inhibitor protein; Raf-1 kinase inhibitor protein
Chromosome
5
Map Location
5 F|5 56.88 cM

Proteins

phosphatidylethanolamine-binding protein 1
Refseq ID NP_061346
Protein GI 84794552
UniProt ID P70296
mRNA ID NM_018858
Length 187
RefSeq Status PROVISIONAL
MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK

Gene Information

Entrez Gene ID
23980
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Pebp1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0045177 IEA:Ensembl C apical part of cell
GO:0043679 IEA:Ensembl C axon terminus
GO:0009986 IDA:MGI C cell surface
GO:0005615 IEA:Ensembl C extracellular space
GO:0005741 IEA:Ensembl C mitochondrial outer membrane
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0005791 IEA:Ensembl C rough endoplasmic reticulum
GO:0008021 IEA:Ensembl C synaptic vesicle
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0004867 IEA:UniProtKB-KW F serine-type endopeptidase inhibitor activity
GO:0000165 IEA:Ensembl P MAPK cascade
GO:0007568 IEA:Ensembl P aging
GO:0007420 IEA:Ensembl P brain development
GO:0042755 IEA:Ensembl P eating behavior
GO:0043409 IEA:Ensembl P negative regulation of MAPK cascade
GO:0001933 IEA:Ensembl P negative regulation of protein phosphorylation
GO:0060409 IEA:Ensembl P positive regulation of acetylcholine metabolic process
GO:0043950 IEA:Ensembl P positive regulation of cAMP-mediated signaling
GO:0045840 IEA:Ensembl P positive regulation of mitosis
GO:0001505 IEA:Ensembl P regulation of neurotransmitter levels
GO:0002026 IEA:Ensembl P regulation of the force of heart contraction
GO:0014823 IEA:Ensembl P response to activity
GO:0051591 IEA:Ensembl P response to cAMP
GO:0051592 IEA:Ensembl P response to calcium ion
GO:0051412 IEA:Ensembl P response to corticosterone
GO:0042493 IEA:Ensembl P response to drug
GO:0051602 IEA:Ensembl P response to electrical stimulus
GO:0045471 IEA:Ensembl P response to ethanol
GO:0009408 IEA:Ensembl P response to heat
GO:0006979 IEA:Ensembl P response to oxidative stress
GO:0009636 IEA:Ensembl P response to toxic substance
GO:0009611 IEA:Ensembl P response to wounding
GO:0048240 IDA:MGI P sperm capacitation

Domain Information

InterPro Annotations

Accession Description
IPR008914 Phosphatidylethanolamine-binding protein PEBP
IPR001858 Phosphatidylethanolamine-binding, conserved site

UniProt Annotations

Entry Information

Gene Name
phosphatidylethanolamine binding protein 1
Protein Entry
PEBP1_MOUSE
UniProt ID
P70296
Species
Mouse

Comments

Comment Type Description
Function Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity). {ECO:0000250}.
Function HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor (By similarity). {ECO:0000250}.
Similarity Belongs to the phosphatidylethanolamine-binding protein family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Has a tendency to form dimers by disulfide cross-linking. Interacts with RAF1 and this interaction is enhanced if RAF1 is phosphorylated on residues 'Ser-338', 'Ser-339', 'Tyr-340' and 'Tyr-341'. Interacts with ALOX15; in response to IL13/interleukin- 13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade (By similarity). {ECO:0000250}.
Tissue Specificity HCNP is expressed in brain. Increased expression in aged senescence-accelerated mice.

Identical and Related Proteins

Unique RefSeq proteins for LMP000833 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
84794552 RefSeq NP_061346 187 phosphatidylethanolamine-binding protein 1

Identical Sequences to LMP000833 proteins

Reference Database Accession Length Protein Name
GI:84794552 DBBJ BAE25588.1 187 unnamed protein product [Mus musculus]
GI:84794552 DBBJ BAE35420.1 187 unnamed protein product [Mus musculus]
GI:84794552 DBBJ BAE29101.1 187 unnamed protein product [Mus musculus]
GI:84794552 GenBank AAH89332.1 187 Phosphatidylethanolamine binding protein 1 [Mus musculus]
GI:84794552 GenBank ABH66159.1 187 Sequence 1 from patent US 7029877
GI:84794552 GenBank EDL19813.1 187 mCG7941, isoform CRA_f [Mus musculus]

Related Sequences to LMP000833 proteins

Reference Database Accession Length Protein Name
GI:84794552 DBBJ BAE40623.1 187 unnamed protein product [Mus musculus]
GI:84794552 GenBank AAB06983.1 187 phosphatidylethanolamine binding protein [Mus musculus]
GI:84794552 GenBank AAY05173.1 187 Sequence 3 from patent US 6864224
GI:84794552 GenBank EDL04829.1 187 mCG7191 [Mus musculus]
GI:84794552 GenBank EDL19809.1 187 mCG7941, isoform CRA_b [Mus musculus]
GI:84794552 GenBank EDL41540.1 186 mCG13982 [Mus musculus]