Gene/Proteome Database (LMPD)
LMPD ID
LMP000833
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Synonyms
HCNP; Pbp; Pbp1; Pbpr; Rkip
Alternate Names
phosphatidylethanolamine-binding protein 1; HCNPpp; PEBP-1; Raf-1 inhibitor protein; Raf-1 kinase inhibitor protein
Chromosome
5
Map Location
5 F|5 56.88 cM
Proteins
phosphatidylethanolamine-binding protein 1 | |
---|---|
Refseq ID | NP_061346 |
Protein GI | 84794552 |
UniProt ID | P70296 |
mRNA ID | NM_018858 |
Length | 187 |
RefSeq Status | PROVISIONAL |
MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylethanolamine binding protein 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0045177 | IEA:Ensembl | C | apical part of cell |
GO:0043679 | IEA:Ensembl | C | axon terminus |
GO:0009986 | IDA:MGI | C | cell surface |
GO:0005615 | IEA:Ensembl | C | extracellular space |
GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
GO:0005741 | IEA:Ensembl | C | mitochondrial outer membrane |
GO:0043025 | IEA:Ensembl | C | neuronal cell body |
GO:0005791 | IEA:Ensembl | C | rough endoplasmic reticulum |
GO:0008021 | IEA:Ensembl | C | synaptic vesicle |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0004867 | IEA:UniProtKB-KW | F | serine-type endopeptidase inhibitor activity |
GO:0007568 | IEA:Ensembl | P | aging |
GO:0007420 | IEA:Ensembl | P | brain development |
GO:0042755 | IEA:Ensembl | P | eating behavior |
GO:0000165 | IEA:Ensembl | P | MAPK cascade |
GO:0043409 | IEA:Ensembl | P | negative regulation of MAPK cascade |
GO:0001933 | IEA:Ensembl | P | negative regulation of protein phosphorylation |
GO:0060409 | IEA:Ensembl | P | positive regulation of acetylcholine metabolic process |
GO:0043950 | IEA:Ensembl | P | positive regulation of cAMP-mediated signaling |
GO:0045840 | IEA:Ensembl | P | positive regulation of mitosis |
GO:0001505 | IEA:Ensembl | P | regulation of neurotransmitter levels |
GO:0002026 | IEA:Ensembl | P | regulation of the force of heart contraction |
GO:0014823 | IEA:Ensembl | P | response to activity |
GO:0051592 | IEA:Ensembl | P | response to calcium ion |
GO:0051591 | IEA:Ensembl | P | response to cAMP |
GO:0051412 | IEA:Ensembl | P | response to corticosterone |
GO:0042493 | IEA:Ensembl | P | response to drug |
GO:0051602 | IEA:Ensembl | P | response to electrical stimulus |
GO:0045471 | IEA:Ensembl | P | response to ethanol |
GO:0009408 | IEA:Ensembl | P | response to heat |
GO:0006979 | IEA:Ensembl | P | response to oxidative stress |
GO:0009636 | IEA:Ensembl | P | response to toxic substance |
GO:0009611 | IEA:Ensembl | P | response to wounding |
GO:0048240 | IDA:MGI | P | sperm capacitation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylethanolamine binding protein 1
Protein Entry
PEBP1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity). {ECO:0000250}. |
Function | HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor (By similarity). {ECO:0000250}. |
Similarity | Belongs to the phosphatidylethanolamine-binding protein family. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Subunit | Has a tendency to form dimers by disulfide cross-linking. Interacts with RAF1 and this interaction is enhanced if RAF1 is phosphorylated on residues 'Ser-338', 'Ser-339', 'Tyr-340' and 'Tyr-341'. Interacts with ALOX15; in response to IL13/interleukin- 13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade (By similarity). {ECO:0000250}. |
Tissue Specificity | HCNP is expressed in brain. Increased expression in aged senescence-accelerated mice. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000833 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
84794552 | RefSeq | NP_061346 | 187 | phosphatidylethanolamine-binding protein 1 |
Identical Sequences to LMP000833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:84794552 | DBBJ | BAE25588.1 | 187 | unnamed protein product [Mus musculus] |
GI:84794552 | DBBJ | BAE35420.1 | 187 | unnamed protein product [Mus musculus] |
GI:84794552 | DBBJ | BAE29101.1 | 187 | unnamed protein product [Mus musculus] |
GI:84794552 | GenBank | AAH89332.1 | 187 | Phosphatidylethanolamine binding protein 1 [Mus musculus] |
GI:84794552 | GenBank | ABH66159.1 | 187 | Sequence 1 from patent US 7029877 |
GI:84794552 | GenBank | EDL19813.1 | 187 | mCG7941, isoform CRA_f [Mus musculus] |
Related Sequences to LMP000833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:84794552 | DBBJ | BAE40623.1 | 187 | unnamed protein product [Mus musculus] |
GI:84794552 | GenBank | AAB06983.1 | 187 | phosphatidylethanolamine binding protein [Mus musculus] |
GI:84794552 | GenBank | AAY05173.1 | 187 | Sequence 3 from patent US 6864224 |
GI:84794552 | GenBank | EDL04829.1 | 187 | mCG7191 [Mus musculus] |
GI:84794552 | GenBank | EDL19809.1 | 187 | mCG7941, isoform CRA_b [Mus musculus] |
GI:84794552 | GenBank | EDL41540.1 | 186 | mCG13982 [Mus musculus] |