Gene/Proteome Database (LMPD)

LMPD ID
LMP000852
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Gene Symbol
Synonyms
CP12; Cyp1a1; P450-3
Chromosome
9
Map Location
9 B|9 31.3 cM

Proteins

cytochrome P450 1A2
Refseq ID NP_034123
Protein GI 6753566
UniProt ID P00186
mRNA ID NM_009993
Length 513
RefSeq Status PROVISIONAL
MAFSQYISLAPELLLATAIFCLVFWMVRASRTQVPKGLKNPPGPWGLPFIGHMLTVGKNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVRQGDDFKGRPDLYSFTLITNGKSMTFNPDSGPVWAARRRLAQDALKSFSIASDPTSASSCYLEEHVSKEANHLVSKLQKAMAEVGHFEPVSQVVESVANVIGAMCFGKNFPRKSEEMLNIVNNSKDFVENVTSGNAVDFFPVLRYLPNPALKRFKTFNDNFVLFLQKTVQEHYQDFNKNSIQDITSALFKHSENYKDNGGLIPEEKIVNIVNDIFGAGFDTVTTAITWSILLLVTWPNVQRKIHEELDTVVGRDRQPRLSDRPQLPYLEAFILEIYRYTSFVPFTIPHSTTRDTSLNGFHIPKERCIYINQWQVNHDEKQWKDPFVFRPERFLTNNNSAIDKTQSEKVMLFGLGKRRCIGEIPAKWEVFLFLAILLQHLEFSVPPGVKVDLTPNYGLTMKPGTCEHVQAWPRFSK

Gene Information

Entrez Gene ID
Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:UniProtKB-SubCell C endoplasmic reticulum membrane
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0034875 IEA:Ensembl F caffeine oxidase activity
GO:0032451 IEA:Ensembl F demethylase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0016712 IDA:MGI F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0009820 IEA:Ensembl P alkaloid metabolic process
GO:0006725 IMP:MGI P cellular aromatic compound metabolic process
GO:0045333 IMP:MGI P cellular respiration
GO:0071276 IDA:MGI P cellular response to cadmium ion
GO:0018894 IMP:MGI P dibenzo-p-dioxin metabolic process
GO:0017144 IMP:MGI P drug metabolic process
GO:0042738 IEA:Ensembl P exogenous drug catabolic process
GO:0050665 IMP:MGI P hydrogen peroxide biosynthetic process
GO:0030324 IMP:MGI P lung development
GO:0032787 IEA:Ensembl P monocarboxylic acid metabolic process
GO:0016098 IEA:Ensembl P monoterpenoid metabolic process
GO:0071615 IEA:Ensembl P oxidative deethylation
GO:0070989 IEA:Ensembl P oxidative demethylation
GO:0006778 IMP:MGI P porphyrin-containing compound metabolic process
GO:0009791 IMP:MGI P post-embryonic development
GO:0010468 IMP:MGI P regulation of gene expression
GO:0032355 IEA:Ensembl P response to estradiol
GO:0035902 IEA:Ensembl P response to immobilization stress
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0006706 IEA:Ensembl P steroid catabolic process
GO:0009403 IEA:Ensembl P toxin biosynthetic process
GO:0009404 IMP:MGI P toxin metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR008066 Cytochrome P450, E-class, group I, CYP1
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 1, subfamily a, polypeptide 2
Protein Entry
CP1A2_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Note=Heme group. ;
Function Cytochromes P450 are a group of heme-thiolate monooxygenases.
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane .

Identical and Related Proteins

Unique RefSeq proteins for LMP000852 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753566 RefSeq NP_034123 513 cytochrome P450 1A2

Identical Sequences to LMP000852 proteins

Reference Database Accession Length Protein Name
GI:6753566 GenBank AAA37508.1 513 cytochrome P3-450 [Mus musculus]
GI:6753566 GenBank AAH18298.1 513 Cytochrome P450, family 1, subfamily a, polypeptide 2 [Mus musculus]
GI:6753566 GenBank AAH54827.1 513 Cytochrome P450, family 1, subfamily a, polypeptide 2 [Mus musculus]
GI:6753566 GenBank EDL25920.1 513 mCG4004 [Mus musculus]
GI:6753566 GenBank ACJ12937.1 513 cytochrome P450 family 1 subfamily a polypeptide 2 [Mus musculus]
GI:6753566 SwissProt P00186.1 513 RecName: Full=Cytochrome P450 1A2; AltName: Full=CYPIA2; AltName: Full=Cytochrome P450-P2; AltName: Full=Cytochrome P450-P3 [Mus musculus]

Related Sequences to LMP000852 proteins

Reference Database Accession Length Protein Name
GI:6753566 EMBL CAA27832.1 513 unnamed protein product [Mus musculus]
GI:6753566 GenBank AAA41053.1 513 cytochrome P-450d [Rattus norvegicus]
GI:6753566 GenBank AAA37509.1 513 cytochrome P3 [Mus musculus]
GI:6753566 GenBank AAI27477.1 513 Cytochrome P450, family 1, subfamily a, polypeptide 2 [Rattus norvegicus]
GI:6753566 RefSeq NP_036673.3 513 cytochrome P450 1A2 [Rattus norvegicus]
GI:6753566 SwissProt P04799.2 513 RecName: Full=Cytochrome P450 1A2; AltName: Full=CYPIA2; AltName: Full=Cytochrome P-448; AltName: Full=Cytochrome P-450d; AltName: Full=Cytochrome P450-D [Rattus norvegicus]