Gene/Proteome Database (LMPD)
LMPD ID
LMP000873
Gene ID
Species
Mus musculus (Mouse)
Gene Name
peroxisomal trans-2-enoyl-CoA reductase
Gene Symbol
Synonyms
2400003B18Rik; TERP
Alternate Names
peroxisomal trans-2-enoyl-CoA reductase; perosisomal 2-enoyl-CoA reductase
Chromosome
1
Map Location
1 C3|1 36.46 cM
EC Number
1.3.1.38
Proteins
peroxisomal trans-2-enoyl-CoA reductase | |
---|---|
Refseq ID | NP_076012 |
Protein GI | 227908837 |
UniProt ID | Q99MZ7 |
mRNA ID | NM_023523 |
Length | 303 |
RefSeq Status | VALIDATED |
MGSWKTGQSYLAAGLLKNQVAVVTGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNIRKEEEVSNLVKSTLAKYGKINFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNNGFPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQTLFEMAFDSIPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQALYTHAFSIPDHDNWPVGAGDLSIVKRIKESFKKKAKL |
Gene Information
Entrez Gene ID
Gene Name
peroxisomal trans-2-enoyl-CoA reductase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0043231 | ISS:UniProtKB | C | intracellular membrane-bounded organelle |
GO:0005739 | IDA:UniProtKB | C | mitochondrion |
GO:0005778 | ISS:UniProtKB | C | peroxisomal membrane |
GO:0005777 | ISA:MGI | C | peroxisome |
GO:0019166 | ISS:UniProtKB | F | trans-2-enoyl-CoA reductase (NADPH) activity |
GO:0030497 | ISA:MGI | P | fatty acid elongation |
GO:0033306 | IEA:Ensembl | P | phytol metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
peroxisomal trans-2-enoyl-CoA reductase
Protein Entry
PECR_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH. |
Function | Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity (By similarity). {ECO:0000250}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
Subcellular Location | Peroxisome {ECO:0000250}. |
Subunit | Interacts with PEX5, probably required to target it into peroxisomes. {ECO:0000250}. |
Tissue Specificity | Highly expressed in liver and kidney. Expressed at lowe level in heart and skeletal muscle. Expressed at weak level in other tissues. {ECO:0000269|PubMed:10811639}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000873 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
227908837 | RefSeq | NP_076012 | 303 | peroxisomal trans-2-enoyl-CoA reductase |
Identical Sequences to LMP000873 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:227908837 | GenBank | AAK28336.1 | 303 | peroxisomal 2-enoyl-CoA reductase [Mus musculus] |
GI:227908837 | GenBank | AAH13530.1 | 303 | Peroxisomal trans-2-enoyl-CoA reductase [Mus musculus] |
GI:227908837 | GenBank | EDL00278.1 | 303 | peroxisomal trans-2-enoyl-CoA reductase, isoform CRA_b [Mus musculus] |
GI:227908837 | GenBank | EDL00279.1 | 303 | peroxisomal trans-2-enoyl-CoA reductase, isoform CRA_c [Mus musculus] |
GI:227908837 | SwissProt | Q99MZ7.1 | 303 | RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase; Short=TERP [Mus musculus] |
Related Sequences to LMP000873 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:227908837 | DBBJ | BAB26803.1 | 303 | unnamed protein product [Mus musculus] |
GI:227908837 | GenBank | AAD38447.1 | 303 | putative short-chain dehydrogenase/reductase [Rattus norvegicus] |
GI:227908837 | GenBank | AAF14047.1 | 303 | peroxisomal 2,4-dienoyl CoA reductase px-2,4-DCR#1 [Rattus norvegicus] |
GI:227908837 | GenBank | AAF69800.1 | 303 | peroxisomal trans 2-enoyl CoA reductase [Mus musculus] |
GI:227908837 | GenBank | AAO99156.1 | 303 | Sequence 25 from patent US 6511834 |
GI:227908837 | GenBank | ACP59667.1 | 303 | Sequence 13 from patent US 7494793 |