Gene/Proteome Database (LMPD)

LMPD ID
LMP000912
Gene ID
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Synonyms
FABPI; I-FABP
Alternate Names
fatty acid-binding protein, intestinal; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein
Chromosome
4
Map Location
4q28-q31
Summary
The intracellular fatty acid-binding proteins (FABPs) belong to a multigene family with nearly twenty identified members. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Intestinal fatty acid-binding protein 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. This gene has a polymorphism at codon 54 that identified an alanine-encoding allele and a threonine-encoding allele. Thr-54 protein is associated with increased fat oxidation and insulin resistance. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

fatty acid-binding protein, intestinal
Refseq ID NP_000125
Protein GI 194097325
UniProt ID P12104
mRNA ID NM_000134
Length 132
RefSeq Status REVIEWED
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005504 TAS:ProtInc F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0007586 TAS:ProtInc P digestion

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
ko04975 Fat digestion and absorption
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 2, intestinal
Protein Entry
FABPI_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
Induction By EGF.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.
Tissue Specificity Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.

Identical and Related Proteins

Unique RefSeq proteins for LMP000912 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
194097325 RefSeq NP_000125 132 fatty acid-binding protein, intestinal

Identical Sequences to LMP000912 proteins

Reference Database Accession Length Protein Name
GI:194097325 GenBank AAI11792.1 132 Fatty acid binding protein 2, intestinal [Homo sapiens]

Related Sequences to LMP000912 proteins

Reference Database Accession Length Protein Name
GI:194097325 GenBank AAH69637.1 132 Fatty acid binding protein 2, intestinal [Homo sapiens]
GI:194097325 GenBank EAW73666.1 132 fatty acid binding protein 2, intestinal [Homo sapiens]
GI:194097325 GenBank ABY15170.1 132 Sequence 545 from patent US 7306913
GI:194097325 GenBank ADQ32865.1 132 fatty acid binding protein 2, intestinal, partial [synthetic construct]
GI:194097325 GenBank ADS31041.1 132 Sequence 1573 from patent US 7781168
GI:194097325 GenBank AIC54369.1 132 FABP2, partial [synthetic construct]