Gene/Proteome Database (LMPD)

LMPD ID
LMP000913
Gene ID
108078
Species
Mus musculus (Mouse)
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
Olr1
Synonyms
LOX-1; SR-EI; Scare1
Chromosome
6
Map Location
6 F3|6

Proteins

oxidized low-density lipoprotein receptor 1 isoform 1
Refseq ID NP_619589
Protein GI 134053881
UniProt ID Q9EQ09
mRNA ID NM_138648
Length 363
RefSeq Status VALIDATED
MTFDDKMKPANDEPDQKSCGKKPKGLHLLSSPWWFPAAMTLVILCLVLSVTLIVQWTQLRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI
oxidized low-density lipoprotein receptor 1 isoform 2
Refseq ID NP_001288025
Protein GI 666875863
UniProt ID G4WK09
mRNA ID NM_001301096
Length 155
RefSeq Status VALIDATED
MTFDDKMKPANDEPDQKSCGKKPKGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI
oxidized low-density lipoprotein receptor 1 isoform 3
Refseq ID NP_001288023
Protein GI 666875833
UniProt ID G4WK10
mRNA ID NM_001301094
Length 189
RefSeq Status VALIDATED
MTFDDKMKPANDEPDQKSCGKKPKGLHLLSSPWWFPAAMTLVILCLVLSVTLIVQWTQCPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Gene Information

Entrez Gene ID
108078
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
Olr1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0019897 TAS:MGI C extrinsic component of plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IEA:Ensembl C nucleus
GO:0043235 ISO:MGI C receptor complex
GO:0030246 IEA:UniProtKB-KW F carbohydrate binding
GO:0005041 IDA:MGI F low-density lipoprotein receptor activity
GO:0008219 IEA:Ensembl P cell death
GO:0002376 IEA:UniProtKB-KW P immune system process
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0007159 IEA:Ensembl P leukocyte cell-cell adhesion
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0006898 IDA:GOC P receptor-mediated endocytosis
GO:0042542 IEA:Ensembl P response to hydrogen peroxide

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mmu03320 PPAR signaling pathway
ko04145 Phagosome
mmu04145 Phagosome

REACTOME Pathway Links

REACTOME Pathway ID Description
5893160 Cell surface interactions at the vascular wall
5893155 Hemostasis

Domain Information

InterPro Annotations

Accession Description
IPR001304 C-type_lectin
IPR016186 C-type_lectin-like
IPR016187 C-type_lectin_fold

UniProt Annotations

Entry Information

Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Protein Entry
OLR1_MOUSE
UniProt ID
Q9EQ09
Species
Mouse

Comments

Comment Type Description
Domain The C-type lectin domain mediates the recognition and binding of oxLDL. {ECO:0000250}.
Domain The Neck region contains 3 internal repeats that are only found in rodents.
Domain The cytoplasmic region is required for subcellular sorting on the cell surface. {ECO:0000250}.
Function Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria (By similarity). {ECO:0000250}.
Ptm N-glycosylated. {ECO:0000250}.
Similarity Contains 1 C-type lectin domain. {ECO:0000255|PROSITE- ProRule:PRU00040}.
Subcellular Location Cell membrane {ECO:0000250}; Lipid-anchor {ECO:0000250}. Cell membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Membrane raft {ECO:0000250}. Secreted {ECO:0000250}. Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation (By similarity). {ECO:0000250}.
Subunit Homodimer; disulfide-linked. May form a hexamer composed of 3 homodimers. Interacts with HSP70 (By similarity). {ECO:0000250}.
Web Resource Name=Functional Glycomics Gateway - Glycan Binding; Note=Oxidised LDL receptor; URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_mou_Ctlect_179";

Identical and Related Proteins

Unique RefSeq proteins for LMP000913 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
134053881 RefSeq NP_619589 363 oxidized low-density lipoprotein receptor 1 isoform 1
666875863 RefSeq NP_001288025 155 oxidized low-density lipoprotein receptor 1 isoform 2
666875833 RefSeq NP_001288023 189 oxidized low-density lipoprotein receptor 1 isoform 3

Identical Sequences to LMP000913 proteins

Reference Database Accession Length Protein Name
GI:134053881 DBBJ BAE32764.1 363 unnamed protein product [Mus musculus]
GI:666875863 GenBank AAV21503.1 155 Sequence 18 from patent US 6756228
GI:134053881 GenBank AAV21504.1 363 Sequence 20 from patent US 6756228
GI:134053881 GenBank AAI48551.1 363 Oxidized low density lipoprotein (lectin-like) receptor 1, partial [synthetic construct]
GI:666875863 GenBank AEQ16487.1 155 oxidized low density lipoprotein (lectin-like) receptor 1 isoform 2 [Mus musculus]
GI:666875833 GenBank AEQ16488.1 189 oxidized low density lipoprotein (lectin-like) receptor 1 isoform 3 [Mus musculus]
GI:134053881 SwissProt Q9EQ09.2 363 RecName: Full=Oxidized low-density lipoprotein receptor 1; Short=Ox-LDL receptor 1; AltName: Full=Lectin-like oxidized LDL receptor 1; Short=LOX-1; Short=Lectin-like oxLDL receptor 1; AltName: Full=Lectin-type oxidized LDL receptor 1; Contains: RecName: Full=Oxidized low-density lipoprotein receptor 1, soluble form [Mus musculus]

Related Sequences to LMP000913 proteins

Reference Database Accession Length Protein Name
GI:134053881 DBBJ BAA35123.1 364 lectin-like oxidized low-density lipoprotein receptor [Rattus norvegicus]
GI:666875833 GenBank AAG44998.1 363 oxidized LDL receptor [Mus musculus]
GI:134053881 GenBank AAG44998.1 363 oxidized LDL receptor [Mus musculus]
GI:666875863 GenBank AAG44998.1 363 oxidized LDL receptor [Mus musculus]
GI:666875863 GenBank AAV21502.1 201 Sequence 16 from patent US 6756228
GI:666875833 GenBank AAV21502.1 201 Sequence 16 from patent US 6756228
GI:666875833 GenBank AAV21503.1 155 Sequence 18 from patent US 6756228
GI:134053881 GenBank EDK99928.1 367 oxidized low density lipoprotein (lectin-like) receptor 1 [Mus musculus]
GI:666875863 GenBank ADS49393.1 363 Sequence 84 from patent US 7803637
GI:134053881 GenBank ADS49393.1 363 Sequence 84 from patent US 7803637
GI:666875833 GenBank AEQ16487.1 155 oxidized low density lipoprotein (lectin-like) receptor 1 isoform 2 [Mus musculus]
GI:666875863 GenBank AEQ16488.1 189 oxidized low density lipoprotein (lectin-like) receptor 1 isoform 3 [Mus musculus]
GI:666875833 GenBank AGV80648.1 363 Sequence 84 from patent US 8524218
GI:666875863 GenBank AGV80648.1 363 Sequence 84 from patent US 8524218
GI:134053881 GenBank AGV80648.1 363 Sequence 84 from patent US 8524218
GI:134053881 RefSeq XP_006505366.1 317 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X1 [Mus musculus]
GI:666875863 RefSeq NP_001288023.1 189 oxidized low-density lipoprotein receptor 1 isoform 3 [Mus musculus]
GI:666875833 RefSeq NP_001288025.1 155 oxidized low-density lipoprotein receptor 1 isoform 2 [Mus musculus]