Gene/Proteome Database (LMPD)
LMPD ID
LMP000928
Gene ID
Species
Mus musculus (Mouse)
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Gene Symbol
Synonyms
CIN-2; Cig30
Alternate Names
elongation of very long chain fatty acids protein 3; ELOVL FA elongase 3; ELOVL fatty acid elongase 3; cold inducible glycoprotein 30; 3-keto acyl-CoA synthase Elovl3; cold-inducible glycoprotein of 30 kDa; very-long-chain 3-oxoacyl-CoA synthase 3; elongation of very long chain fatty acids-like 3
Chromosome
19
Map Location
19 C3|19 38.75 cM
EC Number
2.3.1.199
Proteins
| elongation of very long chain fatty acids protein 3 | |
|---|---|
| Refseq ID | NP_031729 |
| Protein GI | 6671752 |
| UniProt ID | O35949 |
| mRNA ID | NM_007703 |
| Length | 271 |
| RefSeq Status | VALIDATED |
| MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ | |
Gene Information
Entrez Gene ID
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0034625 | IMP:UniProtKB | P | fatty acid elongation, monounsaturated fatty acid |
| GO:0034626 | IEA:Ensembl | P | fatty acid elongation, polyunsaturated fatty acid |
| GO:0019367 | IMP:UniProtKB | P | fatty acid elongation, saturated fatty acid |
| GO:0042761 | IMP:UniProtKB | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00062 | Fatty acid elongation |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Protein Entry
ELOV3_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Disruption Phenotype | Mutant mice grow normally and are fertile. They display a sparse hair coat, a hyperplastic pilosebaceous system and their hair lipid content is disturbed with exceptionally high levels of eicosenoic acid (20:1). In the triglyceride fraction, fatty acids longer than 20 carbon atoms are almost undetectable. As a result, mice exhibited a severe defect in water repulsion and increased trans-epidermal water loss. When exposed to cold stress, mutants exhibit a significantly reduced VLCFA elongation activity in brown adipose tissue, but only during the initial phase. Cold-acclimated mutants are equally efficient as normal mice at elongating fatty acids. Mutant mice are lean and resistant to diet-induced weight gain, they show normal food intake but increased metabolic rate, and show reduced hepatic lipogenesis and triglycerides synthesis. {ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:16326704, ECO:0000269|PubMed:20605947}. |
| Function | Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs) of up to 24 carbon atoms. Participates in the formation of certain VLCFA and triglycerides in certain cells of the hair follicles and the sebaceous glands, required for skin barrier function. Critical enzyme for lipid accumulation and metabolic activity in brown adipocytes during the early phase of the tissue recruitment. Play a role in lipid storage and in resistance to diet-induced obesity. {ECO:0000269|PubMed:10791983, ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:16326704, ECO:0000269|PubMed:20605947}. |
| Induction | Strongly up-regulated in brown adipose tissue in conditions of brown fat recruitment, such as cold stress, perinatal development and after diet-induced thermogenesis. A synergistic action of both catecholamines and glucocorticoids is required for the induction. |
| Similarity | Belongs to the ELO family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:10429212}; Multi-pass membrane protein {ECO:0000269|PubMed:10429212}. |
| Tissue Specificity | Expressed in brown adipose tissue and liver. In the skin, strong expressed in the cells of the inner layer of the outer root sheath of the hair follicles and in the sebocytes of the sebaceous glands. Hardly detectable in the epidermis and not at all in fibroblasts. {ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:9395518}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000928 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6671752 | RefSeq | NP_031729 | 271 | elongation of very long chain fatty acids protein 3 |
Identical Sequences to LMP000928 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6671752 | GenBank | AAS29238.1 | 271 | Sequence 53 from patent US 6677145 |
| GI:6671752 | GenBank | ABA13346.1 | 271 | Sequence 52 from patent US 6913916 |
| GI:6671752 | GenBank | ABH98606.1 | 271 | Sequence 50 from patent US 7070970 |
| GI:6671752 | GenBank | EDL41980.1 | 271 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Mus musculus] |
| GI:6671752 | GenBank | ACE40460.1 | 271 | Sequence 53 from patent US 7375205 |
| GI:6671752 | GenBank | AEJ72113.1 | 271 | Sequence 53 from patent US 7968692 |
Related Sequences to LMP000928 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6671752 | GenBank | AAN18899.1 | 272 | Sequence 18 from patent US 6403349 |
| GI:6671752 | GenBank | AAS29209.1 | 272 | Sequence 24 from patent US 6677145 |
| GI:6671752 | GenBank | ABA13317.1 | 272 | Sequence 23 from patent US 6913916 |
| GI:6671752 | GenBank | ABH98577.1 | 272 | Sequence 21 from patent US 7070970 |
| GI:6671752 | GenBank | ACE40431.1 | 272 | Sequence 24 from patent US 7375205 |
| GI:6671752 | GenBank | AEJ72084.1 | 272 | Sequence 24 from patent US 7968692 |