Gene/Proteome Database (LMPD)

LMPD ID
LMP000928
Gene ID
12686
Species
Mus musculus (Mouse)
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Gene Symbol
Elovl3
Synonyms
CIN-2; Cig30
Alternate Names
elongation of very long chain fatty acids protein 3; ELOVL FA elongase 3; ELOVL fatty acid elongase 3; cold inducible glycoprotein 30; 3-keto acyl-CoA synthase Elovl3; cold-inducible glycoprotein of 30 kDa; very-long-chain 3-oxoacyl-CoA synthase 3; elongation of very long chain fatty acids-like 3
Chromosome
19
Map Location
19 C3|19 38.75 cM
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 3
Refseq ID NP_031729
Protein GI 6671752
UniProt ID O35949
mRNA ID NM_007703
Length 271
RefSeq Status VALIDATED
MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHSVMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYFILFAHFFHRAYLRPKGKVASKSQ

Gene Information

Entrez Gene ID
12686
Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Gene Symbol
Elovl3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0034625 IMP:UniProtKB P fatty acid elongation, monounsaturated fatty acid
GO:0034626 IEA:Ensembl P fatty acid elongation, polyunsaturated fatty acid
GO:0019367 IMP:UniProtKB P fatty acid elongation, saturated fatty acid
GO:0042761 IMP:UniProtKB P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5893735 REV-ERBA represses gene expression
5892981 Synthesis of very long-chain fatty acyl-CoAs

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
Protein Entry
ELOV3_MOUSE
UniProt ID
O35949
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Disruption Phenotype Mutant mice grow normally and are fertile. They display a sparse hair coat, a hyperplastic pilosebaceous system and their hair lipid content is disturbed with exceptionally high levels of eicosenoic acid (20:1). In the triglyceride fraction, fatty acids longer than 20 carbon atoms are almost undetectable. As a result, mice exhibited a severe defect in water repulsion and increased trans-epidermal water loss. When exposed to cold stress, mutants exhibit a significantly reduced VLCFA elongation activity in brown adipose tissue, but only during the initial phase. Cold-acclimated mutants are equally efficient as normal mice at elongating fatty acids. Mutant mice are lean and resistant to diet-induced weight gain, they show normal food intake but increased metabolic rate, and show reduced hepatic lipogenesis and triglycerides synthesis. {ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:16326704, ECO:0000269|PubMed:20605947}.
Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs) of up to 24 carbon atoms. Participates in the formation of certain VLCFA and triglycerides in certain cells of the hair follicles and the sebaceous glands, required for skin barrier function. Critical enzyme for lipid accumulation and metabolic activity in brown adipocytes during the early phase of the tissue recruitment. Play a role in lipid storage and in resistance to diet-induced obesity. {ECO:0000269|PubMed:10791983, ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:16326704, ECO:0000269|PubMed:20605947}.
Induction Strongly up-regulated in brown adipose tissue in conditions of brown fat recruitment, such as cold stress, perinatal development and after diet-induced thermogenesis. A synergistic action of both catecholamines and glucocorticoids is required for the induction.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:10429212}; Multi-pass membrane protein {ECO:0000269|PubMed:10429212}.
Tissue Specificity Expressed in brown adipose tissue and liver. In the skin, strong expressed in the cells of the inner layer of the outer root sheath of the hair follicles and in the sebocytes of the sebaceous glands. Hardly detectable in the epidermis and not at all in fibroblasts. {ECO:0000269|PubMed:14581464, ECO:0000269|PubMed:9395518}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000928 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6671752 RefSeq NP_031729 271 elongation of very long chain fatty acids protein 3

Identical Sequences to LMP000928 proteins

Reference Database Accession Length Protein Name
GI:6671752 GenBank AAS29238.1 271 Sequence 53 from patent US 6677145
GI:6671752 GenBank ABA13346.1 271 Sequence 52 from patent US 6913916
GI:6671752 GenBank ABH98606.1 271 Sequence 50 from patent US 7070970
GI:6671752 GenBank EDL41980.1 271 elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 [Mus musculus]
GI:6671752 GenBank ACE40460.1 271 Sequence 53 from patent US 7375205
GI:6671752 GenBank AEJ72113.1 271 Sequence 53 from patent US 7968692

Related Sequences to LMP000928 proteins

Reference Database Accession Length Protein Name
GI:6671752 GenBank AAN18899.1 272 Sequence 18 from patent US 6403349
GI:6671752 GenBank AAS29209.1 272 Sequence 24 from patent US 6677145
GI:6671752 GenBank ABA13317.1 272 Sequence 23 from patent US 6913916
GI:6671752 GenBank ABH98577.1 272 Sequence 21 from patent US 7070970
GI:6671752 GenBank ACE40431.1 272 Sequence 24 from patent US 7375205
GI:6671752 GenBank AEJ72084.1 272 Sequence 24 from patent US 7968692