Gene/Proteome Database (LMPD)
LMPD ID
LMP000968
Gene ID
Species
Homo sapiens (Human)
Gene Name
N(alpha)-acetyltransferase 20, NatB catalytic subunit
Gene Symbol
Synonyms
NAT3; NAT3P; NAT5; NAT5P; dJ1002M8.1
Chromosome
20
Map Location
20p11.23
EC Number
2.3.1.88
Summary
NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]
Orthologs
Proteins
N-alpha-acetyltransferase 20 isoform a | |
---|---|
Refseq ID | NP_057184 |
Protein GI | 7705823 |
UniProt ID | P61599 |
mRNA ID | NM_016100 |
Length | 178 |
RefSeq Status | VALIDATED |
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE |
N-alpha-acetyltransferase 20 isoform b | |
---|---|
Refseq ID | NP_852668 |
Protein GI | 31563512 |
UniProt ID | A8MZB2 |
mRNA ID | NM_181527 |
Length | 166 |
RefSeq Status | VALIDATED |
MLSQSCNLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE |
Gene Information
Entrez Gene ID
Gene Name
N(alpha)-acetyltransferase 20, NatB catalytic subunit
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0005622 | IDA:LIFEdb | C | intracellular |
GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
GO:0004596 | IEA:UniProtKB-EC | F | peptide alpha-N-acetyltransferase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
N(alpha)-acetyltransferase 20, NatB catalytic subunit
Protein Entry
NAA20_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P61599-1; Sequence=Displayed; Name=2; IsoId=P61599-2; Sequence=VSP_045644; Note=No experimental confirmation available.; |
Catalytic Activity | Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA. |
Function | Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration. |
Sequence Caution | Sequence=BG548527; Type=Frameshift; Positions=111; Evidence= ; |
Similarity | Belongs to the acetyltransferase family. ARD1 subfamily. |
Similarity | Contains 1 N-acetyltransferase domain. |
Subcellular Location | Cytoplasm . Nucleus . |
Subunit | Component of the N-terminal acetyltransferase B (NatB) complex which is composed of NAA20 and NAA25. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000968 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
7705823 | RefSeq | NP_057184 | 178 | N-alpha-acetyltransferase 20 isoform a |
31563512 | RefSeq | NP_852668 | 166 | N-alpha-acetyltransferase 20 isoform b |
31563514 | RefSeq | NP_852669 | 111 | N-alpha-acetyltransferase 20 isoform c |
Identical Sequences to LMP000968 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31563512 | GenBank | EAX10213.1 | 166 | N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), isoform CRA_a [Homo sapiens] |
GI:31563514 | GenBank | EAX10214.1 | 111 | N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), isoform CRA_b [Homo sapiens] |
GI:31563514 | GenBank | ACJ89802.1 | 111 | Sequence 6223 from patent US 7413875 |
GI:31563514 | GenBank | JAA12537.1 | 111 | N(alpha)-acetyltransferase 20, NatB catalytic subunit [Pan troglodytes] |
GI:31563514 | GenBank | AHD80504.1 | 111 | Sequence 32850 from patent US 8586006 |
GI:31563514 | RefSeq | XP_003316893.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X2 [Pan troglodytes] |
GI:31563512 | RefSeq | XP_004061920.1 | 166 | PREDICTED: N-alpha-acetyltransferase 20 isoform 2 [Gorilla gorilla gorilla] |
GI:31563514 | RefSeq | XP_004061921.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform 3 [Gorilla gorilla gorilla] |
GI:31563512 | RefSeq | XP_005568287.1 | 166 | PREDICTED: N-alpha-acetyltransferase 20 isoform X2 [Macaca fascicularis] |
GI:7705823 | RefSeq | XP_007959542.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 [Chlorocebus sabaeus] |
GI:7705823 | RefSeq | XP_008050898.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 isoform X1 [Tarsius syrichta] |
GI:7705823 | RefSeq | XP_008139351.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 isoform X1 [Eptesicus fuscus] |
GI:7705823 | RefSeq | XP_008586473.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 isoform X1 [Galeopterus variegatus] |
GI:7705823 | RefSeq | XP_008839549.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 [Nannospalax galili] |
GI:7705823 | RefSeq | XP_010367421.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 [Rhinopithecus roxellana] |
Related Sequences to LMP000968 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7705823 | GenBank | AAH44290.1 | 178 | Nat5-prov protein [Xenopus laevis] |
GI:7705823 | GenBank | AAX29528.1 | 179 | N-acetyltransferase 5, partial [synthetic construct] |
GI:7705823 | GenBank | EDL28493.1 | 184 | N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), isoform CRA_f [Mus musculus] |
GI:7705823 | GenBank | EDL95139.1 | 184 | N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae) (predicted), isoform CRA_c [Rattus norvegicus] |
GI:31563512 | GenBank | AFE64678.1 | 178 | N-alpha-acetyltransferase 20 isoform a [Macaca mulatta] |
GI:31563512 | GenBank | AFH28674.1 | 178 | N-alpha-acetyltransferase 20, NatB catalytic subunit isoform a [Macaca mulatta] |
GI:7705823 | RefSeq | NP_001080646.1 | 178 | N-alpha-acetyltransferase 20 [Xenopus laevis] |
GI:31563514 | RefSeq | XP_004270465.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform 2 [Orcinus orca] |
GI:31563514 | RefSeq | XP_004687198.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X2 [Condylura cristata] |
GI:31563512 | RefSeq | XP_005381001.1 | 178 | PREDICTED: N-alpha-acetyltransferase 20 isoform X3 [Chinchilla lanigera] |
GI:31563514 | RefSeq | XP_005568288.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X3 [Macaca fascicularis] |
GI:31563512 | RefSeq | XP_005672789.1 | 201 | PREDICTED: N-alpha-acetyltransferase 20-like isoform X2 [Sus scrofa] |
GI:31563514 | RefSeq | XP_006097588.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X4 [Myotis lucifugus] |
GI:31563512 | RefSeq | XP_006218241.1 | 185 | PREDICTED: N-alpha-acetyltransferase 20 [Vicugna pacos] |
GI:31563514 | RefSeq | XP_007191953.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X3 [Balaenoptera acutorostrata scammoni] |
GI:31563514 | RefSeq | XP_007454589.1 | 111 | PREDICTED: N-alpha-acetyltransferase 20 isoform X2 [Lipotes vexillifer] |
GI:31563512 | RefSeq | XP_008538159.1 | 175 | PREDICTED: N-alpha-acetyltransferase 20 isoform X1 [Equus przewalskii] |
GI:7705823 | SwissProt | Q7ZXR3.1 | 178 | RecName: Full=N-alpha-acetyltransferase 20; AltName: Full=Methionine N-acetyltransferase; AltName: Full=N-acetyltransferase 5; AltName: Full=N-terminal acetyltransferase B complex catalytic subunit NAA20; AltName: Full=N-terminal acetyltransferase B complex catalytic subunit NAT5; Short=NatB complex subunit NAT5; AltName: Full=NatB catalytic subunit [Xenopus laevis] |