Gene/Proteome Database (LMPD)
LMPD ID
LMP000979
Gene ID
Species
Homo sapiens (Human)
Gene Name
colipase, pancreatic
Gene Symbol
Synonyms
-
Alternate Names
colipase; pancreatic colipase preproprotein
Chromosome
6
Map Location
6p21.31
Summary
The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Orthologs
Proteins
| colipase isoform 1 preproprotein | |
|---|---|
| Refseq ID | NP_001823 |
| Protein GI | 4502895 |
| UniProt ID | P04118 |
| mRNA ID | NM_001832 |
| Length | 112 |
| RefSeq Status | REVIEWED |
| MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ | |
| sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1860 peptide sequence: MEKILILLLVALSVAYA mat_peptide: 23..71 product: colipase isoform 3 calculated_mol_wt: 5338 peptide sequence: GIIINLTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1860 peptide sequence: MEKILILLLVALSVAYA mat_peptide: 23..112 product: colipase isoform 1 calculated_mol_wt: 9633 peptide sequence: GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | TAS:Reactome | C | extracellular region |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0008047 | IEA:InterPro | F | enzyme activator activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0044241 | TAS:Reactome | P | lipid digestion |
| GO:0006629 | NAS:ProtInc | P | lipid metabolic process |
| GO:0007603 | TAS:Reactome | P | phototransduction, visible light |
| GO:0001523 | TAS:Reactome | P | retinoid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04975 | Fat digestion and absorption |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_9518 | Digestion of dietary lipid |
| REACT_24968 | Retinoid metabolism and transport |
| REACT_160125 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase. |
| Function | Enterostatin has a biological activity as a satiety signal. |
| Polymorphism | Variant Cys-109 is statistically significantly associated with an increased risk of type 2 diabetes. |
| Similarity | Belongs to the colipase family. {ECO |
| Subcellular Location | Secreted. |
| Subunit | Forms a 1:1 stoichiometric complex with pancreatic lipase. |
| Tissue Specificity | Expressed by the pancreas. |
| Web Resource | Name=Wikipedia; Note=Colipase entry; URL="http://en.wikipedia.org/wiki/Colipase"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000979 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502895 | RefSeq | NP_001823 | 112 | colipase isoform 1 preproprotein |
Identical Sequences to LMP000979 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502895 | GenBank | AAX42012.1 | 112 | colipase pancreatic [synthetic construct] |
| GI:4502895 | GenBank | EAX03850.1 | 112 | colipase, pancreatic, isoform CRA_a [Homo sapiens] |
| GI:4502895 | GenBank | ADZ15980.1 | 112 | colipase, pancreatic, partial [synthetic construct] |
| GI:4502895 | GenBank | AHE01821.1 | 112 | Sequence 58870 from patent US 8586006 |
| GI:4502895 | RefSeq | XP_527612.1 | 112 | PREDICTED: colipase isoform X1 [Pan troglodytes] |
| GI:4502895 | RefSeq | XP_003818968.1 | 112 | PREDICTED: colipase isoform X1 [Pan paniscus] |
Related Sequences to LMP000979 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502895 | GenBank | AAP36174.1 | 113 | Homo sapiens colipase, pancreatic, partial [synthetic construct] |
| GI:4502895 | GenBank | AAX29466.1 | 113 | colipase pancreatic, partial [synthetic construct] |
| GI:4502895 | GenBank | AAX29467.1 | 113 | colipase pancreatic, partial [synthetic construct] |
| GI:4502895 | GenBank | ACM85795.1 | 124 | Sequence 11293 from patent US 6812339 |
| GI:4502895 | RefSeq | XP_003278909.1 | 112 | PREDICTED: colipase isoform 1 [Nomascus leucogenys] |
| GI:4502895 | RefSeq | XP_004043931.1 | 112 | PREDICTED: colipase isoform 1 [Gorilla gorilla gorilla] |