Gene/Proteome Database (LMPD)

LMPD ID
LMP001001
Gene ID
19401
Species
Mus musculus (Mouse)
Gene Name
retinoic acid receptor, alpha
Gene Symbol
Rara
Synonyms
Nr1b1; RAR; RARalpha1
Alternate Names
retinoic acid receptor alpha; RAR-alpha; RAR alpha 1; nuclear receptor subfamily 1 group B member 1
Chromosome
11
Map Location
11 D-E1|11 62.76 cM

Proteins

retinoic acid receptor alpha isoform 1
Refseq ID NP_033050
Protein GI 116734873
UniProt ID P11416
mRNA ID NM_009024
Length 462
RefSeq Status VALIDATED
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
retinoic acid receptor alpha isoform 1
Refseq ID NP_001170774
Protein GI 293336061
UniProt ID P11416
mRNA ID NM_001177303
Length 462
RefSeq Status VALIDATED
Protein sequence is identical to GI:116734873 (mRNA isoform)
retinoic acid receptor alpha isoform 1
Refseq ID NP_001170773
Protein GI 293336010
UniProt ID P11416
mRNA ID NM_001177302
Length 462
RefSeq Status VALIDATED
Protein sequence is identical to GI:116734873 (mRNA isoform)
retinoic acid receptor alpha isoform 2
Refseq ID NP_001169999
Protein GI 293335963
UniProt ID P11416
mRNA ID NM_001176528
Length 459
RefSeq Status VALIDATED
MYESVEVGGLTPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP

Gene Information

Entrez Gene ID
19401
Gene Name
retinoic acid receptor, alpha
Gene Symbol
Rara
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0030425 IDA:MGI C dendrite
GO:0043025 IDA:MGI C neuronal cell body
GO:0000790 IEA:Ensembl C nuclear chromatin
GO:0005634 IDA:UniProtKB C nucleus
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0003677 IDA:MGI F DNA binding
GO:0001012 IDA:MGI F RNA polymerase II regulatory region DNA binding
GO:0000977 IDA:MGI F RNA polymerase II regulatory region sequence-specific DNA binding
GO:0031490 IEA:Ensembl F chromatin DNA binding
GO:0008144 IEA:Ensembl F drug binding
GO:0004879 IDA:MGI F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0048027 IEA:Ensembl F mRNA 5'-UTR binding
GO:0035014 IEA:Ensembl F phosphatidylinositol 3-kinase regulator activity
GO:0001972 IEA:Ensembl F retinoic acid binding
GO:0003708 IDA:MGI F retinoic acid receptor activity
GO:0044323 IEA:Ensembl F retinoic acid-responsive element binding
GO:0043565 IDA:MGI F sequence-specific DNA binding
GO:0003700 IDA:MGI F sequence-specific DNA binding transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0003713 IEA:Ensembl F transcription coactivator activity
GO:0003714 IEA:Ensembl F transcription corepressor activity
GO:0008134 IPI:UniProtKB F transcription factor binding
GO:0044212 IMP:UniProtKB F transcription regulatory region DNA binding
GO:0000900 IEA:Ensembl F translation repressor activity, nucleic acid binding
GO:0008270 IEA:InterPro F zinc ion binding
GO:0060010 IMP:UniProtKB P Sertoli cell fate commitment
GO:0043277 IEA:Ensembl P apoptotic cell clearance
GO:0060348 IGI:MGI P bone development
GO:0071391 IEA:Ensembl P cellular response to estrogen stimulus
GO:0071222 IDA:UniProtKB P cellular response to lipopolysaccharide
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0060591 IMP:MGI P chondroblast differentiation
GO:0031076 IGI:MGI P embryonic camera-type eye development
GO:0060324 IGI:MGI P face development
GO:0007565 IEA:Ensembl P female pregnancy
GO:0007281 IMP:UniProtKB P germ cell development
GO:0002068 IGI:MGI P glandular epithelial cell development
GO:0003417 IGI:MGI P growth plate cartilage development
GO:0030520 IEA:Ensembl P intracellular estrogen receptor signaling pathway
GO:0060173 IGI:MGI P limb development
GO:0001889 IEA:Ensembl P liver development
GO:0035264 IGI:MGI P multicellular organism growth
GO:0043066 IGI:MGI P negative regulation of apoptotic process
GO:0061037 IMP:MGI P negative regulation of cartilage development
GO:0045596 IMP:MGI P negative regulation of cell differentiation
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0010629 IGI:MGI P negative regulation of gene expression
GO:0030853 IEA:Ensembl P negative regulation of granulocyte differentiation
GO:0032689 IEA:Ensembl P negative regulation of interferon-gamma production
GO:0000122 IDA:MGI P negative regulation of transcription from RNA polymerase II promoter
GO:0045892 IDA:MGI P negative regulation of transcription, DNA-templated
GO:0045947 IDA:MGI P negative regulation of translational initiation
GO:0032720 IEA:Ensembl P negative regulation of tumor necrosis factor production
GO:0001843 IGI:MGI P neural tube closure
GO:0003148 IGI:MGI P outflow tract septum morphogenesis
GO:0070374 IEA:Ensembl P positive regulation of ERK1 and ERK2 cascade
GO:0045630 IEA:Ensembl P positive regulation of T-helper 2 cell differentiation
GO:0051099 IEA:Ensembl P positive regulation of binding
GO:0045787 IEA:Ensembl P positive regulation of cell cycle
GO:0008284 IGI:MGI P positive regulation of cell proliferation
GO:0010628 IMP:UniProtKB P positive regulation of gene expression
GO:0032736 IEA:Ensembl P positive regulation of interleukin-13 production
GO:0032753 IEA:Ensembl P positive regulation of interleukin-4 production
GO:0032754 IEA:Ensembl P positive regulation of interleukin-5 production
GO:0045666 IEA:Ensembl P positive regulation of neuron differentiation
GO:0014068 IEA:Ensembl P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0051897 IEA:Ensembl P positive regulation of protein kinase B signaling
GO:0045944 IDA:MGI P positive regulation of transcription from RNA polymerase II promoter
GO:0030850 IEA:Ensembl P prostate gland development
GO:0006468 IEA:Ensembl P protein phosphorylation
GO:0030852 IMP:MGI P regulation of granulocyte differentiation
GO:0031641 IEA:Ensembl P regulation of myelination
GO:0048167 IEA:Ensembl P regulation of synaptic plasticity
GO:0006355 IDA:MGI P regulation of transcription, DNA-templated
GO:0034097 IEA:Ensembl P response to cytokine
GO:0032355 IEA:Ensembl P response to estradiol
GO:0045471 IEA:Ensembl P response to ethanol
GO:0032526 IMP:MGI P response to retinoic acid
GO:0033189 IEA:Ensembl P response to vitamin A
GO:0007283 IMP:MGI P spermatogenesis
GO:0060534 IMP:MGI P trachea cartilage development
GO:0001657 IMP:MGI P ureteric bud development
GO:0055012 IMP:MGI P ventricular cardiac muscle cell differentiation

KEGG Pathway Links

KEGG Pathway ID Description
mmu05221 Acute myeloid leukemia

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003078 Retinoic acid receptor
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor, alpha
Protein Entry
RARA_MOUSE
UniProt ID
P11416
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=Alpha-1; IsoId=P11416-1; Sequence=Displayed; Name=Alpha-2; IsoId=P11416-2; Sequence=VSP_003630;
Disruption Phenotype Seminiferous tubules of 6 month-old animals display varying degrees of testicular degeneration, with moderate to severe levels of germ-cell degeneration. Epithelial cells in the epididymis show general disorganization. Sperm count is reduced to about 1.7% of wild-type and sperm mobility reduced by half. Rara and Rarg, but not Rara and Rarb, double knockout mice exhibit growth retardation after 3 weeks. Defects are found in the growth plates with deficiency in cartilage. Growth retardation was noticable in limb sketal elements such as femurs. Early lethality and male sterility due to squamous metaplasia of the seminal vesicles and prostate are also observed. {ECO:0000269|PubMed:15901285, ECO:0000269|PubMed:17905941, ECO:0000269|PubMed:19389355}.
Domain Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
Function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone acetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. Regulates expression of target genes in a ligand-dependent manner by recruiting chromatin complexes containing KMT2E/MLL5. Mediates retinoic acid-induced granulopoiesis. RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Has a role in the survival of early spermatocytes at the beginning prophase of meiosis. In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function. {ECO:0000269|PubMed:10660575, ECO:0000269|PubMed:15901285, ECO:0000269|PubMed:17205979, ECO:0000269|PubMed:17905941, ECO:0000269|PubMed:19078967, ECO:0000269|PubMed:19389355, ECO:0000269|PubMed:9230306}.
Induction By retinoic acid. {ECO:0000269|PubMed:17905941}.
Interaction Q8C050:Rps6ka5; NbExp=2; IntAct=EBI-346736, EBI-8391218;
Ptm Phosphorylated on serine and threonine residues. Phosphorylation does not change during cell cycle. Phosphorylation on Ser-77 is crucial for the N-terminal AF1 transcriptional activity. Under stress conditions, MAPK8 enhances phosphorylation on Thr-181, Ser-445 and Ser-461 leading to RARA ubiquitination and degradation. Phosphorylation by AKT1 inhibits the transactivation activity. On retinoic acid stimulation, phosphorylation on Ser-369 by RPS6KA5 promotes interaction with GTF2H3 and the CDK7-mediated phosphorylation of Ser-77. {ECO:0000269|PubMed:12079996, ECO:0000269|PubMed:19078967, ECO:0000269|PubMed:9230306}.
Ptm Sumoylated with SUMO2, mainly on Lys-399 which is also required for SENP6 binding. On all-trans retinoic acid (ATRA) binding, a confromational change may occur that allows sumoylation on two additional site, Lys-166 and Lys-171. Probably desumoylated by SENP6. Sumoylation levels determine nuclear localization and regulate ATRA-mediated transcriptional activity (By similarity). {ECO:0000250}.
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily. {ECO:0000305}.
Similarity Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}.
Subcellular Location Nucleus. Cytoplasm. Note=Nuclear localization depends on ligand binding, phosphorylation and sumoylation. Transloaction to the nucleus is dependent on activation of PKC and the downstream MAPK phosphorylation.
Subunit Interacts with PRMT2 (By similarity). Interacts with LRIF1 (By similarity). Interacts with NCOA7 in a ligand-inducible manner. Interacts with KMT2E/MLL5. Interacts (via the ligand- binding domain) with PRAME; interaction is direct and ligand (retinoic acid)-dependent. Interacts with PRKAR1A; the interaction negatively. regulates RARA transcriptional activity. Interacts with NCOR1 and NCOR2; the interaction occurs in the absence of ligand and represses transciptional activity. Interacts with NCOA3 and NCOA6 coactivators, leading to a strong increase of transcription of target genes. Interacts with CDK7; the interaction is enhanced by interaction with GTF2H3. Interacts with GTF2H3; the interaction requires prior phosphorylation on Ser-369 which then enhances interaction with CDK7. Interacts with ASXL1 and NCOA1 (By similarity). {ECO:0000250}.
Tissue Specificity Expressed in Sertoli cells and germ cells. {ECO:0000269|PubMed:17905941}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001001 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
116734873 RefSeq NP_033050 462 retinoic acid receptor alpha isoform 1
293335963 RefSeq NP_001169999 459 retinoic acid receptor alpha isoform 2

Identical Sequences to LMP001001 proteins

Reference Database Accession Length Protein Name
GI:116734873 RefSeq NP_001170773.1 462 retinoic acid receptor alpha isoform 1 [Mus musculus]
GI:116734873 RefSeq NP_001170774.1 462 retinoic acid receptor alpha isoform 1 [Mus musculus]
GI:116734873 RefSeq XP_006532654.1 462 PREDICTED: retinoic acid receptor alpha isoform X1 [Mus musculus]
GI:116734873 RefSeq XP_006532655.1 462 PREDICTED: retinoic acid receptor alpha isoform X2 [Mus musculus]
GI:116734873 RefSeq XP_006532656.1 462 PREDICTED: retinoic acid receptor alpha isoform X3 [Mus musculus]
GI:116734873 RefSeq XP_006532657.1 462 PREDICTED: retinoic acid receptor alpha isoform X4 [Mus musculus]

Related Sequences to LMP001001 proteins

Reference Database Accession Length Protein Name
GI:116734873 EMBL CAA71177.1 462 retinoic acid receptor-alpha [Mus spretus]
GI:293335963 GenBank AAV21454.1 459 Sequence 4 from patent US 6756213
GI:293335963 GenBank AAH99830.1 459 Retinoic acid receptor, alpha [Rattus norvegicus]
GI:293335963 GenBank ABH86777.1 459 Sequence 4 from patent US 7053045
GI:116734873 GenBank EDL16175.1 462 retinoic acid receptor, alpha [Mus musculus]
GI:116734873 GenBank EDM05963.1 462 retinoic acid receptor, alpha, isoform CRA_a [Rattus norvegicus]
GI:293335963 GenBank EDM05964.1 459 retinoic acid receptor, alpha, isoform CRA_b [Rattus norvegicus]
GI:293335963 RefSeq NP_113716.2 459 retinoic acid receptor alpha [Rattus norvegicus]
GI:293335963 RefSeq XP_005368315.1 459 PREDICTED: retinoic acid receptor alpha isoform X2 [Microtus ochrogaster]
GI:116734873 RefSeq XP_008766167.1 462 PREDICTED: retinoic acid receptor alpha isoform X1 [Rattus norvegicus]
GI:116734873 RefSeq XP_008827658.1 462 PREDICTED: retinoic acid receptor alpha isoform X1 [Nannospalax galili]
GI:116734873 RefSeq XP_008827660.1 462 PREDICTED: retinoic acid receptor alpha isoform X1 [Nannospalax galili]