Gene/Proteome Database (LMPD)

LMPD ID
LMP001039
Gene ID
5581
Species
Homo sapiens (Human)
Gene Name
protein kinase C, epsilon
Gene Symbol
PRKCE
Synonyms
PKCE; nPKC-epsilon
Chromosome
2
Map Location
2p21
EC Number
2.7.11.13
Summary
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PRKCE

Proteins

protein kinase C epsilon type
Refseq ID NP_005391
Protein GI 4885563
UniProt ID Q02156
mRNA ID NM_005400
Length 737
RefSeq Status REVIEWED
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Gene Information

Entrez Gene ID
5581
Gene Name
protein kinase C, epsilon
Gene Symbol
PRKCE
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005856 IEA:UniProtKB-SubCell C cytoskeleton
GO:0005829 IEA:Ensembl C cytosol
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0005739 IEA:Ensembl C mitochondrion
GO:0005634 IEA:UniProtKB-SubCell C nucleus
GO:0048471 IEA:UniProtKB-SubCell C perinuclear region of cytoplasm
GO:0005886 IEA:UniProtKB-SubCell C plasma membrane
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004699 IEA:Ensembl F calcium-independent protein kinase C activity
GO:0035276 IEA:Ensembl F ethanol binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0030546 IEA:Ensembl F receptor activator activity
GO:0007155 IEA:UniProtKB-KW P cell adhesion
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0051301 IEA:UniProtKB-KW P cell division
GO:0071361 IEA:Ensembl P cellular response to ethanol
GO:0071456 IEA:Ensembl P cellular response to hypoxia
GO:0035556 IEA:InterPro P intracellular signal transduction
GO:0031663 IEA:Ensembl P lipopolysaccharide-mediated signaling pathway
GO:0035641 IEA:Ensembl P locomotory exploration behavior
GO:0002281 IEA:Ensembl P macrophage activation involved in immune response
GO:0030838 IEA:Ensembl P positive regulation of actin filament polymerization
GO:0010811 IEA:Ensembl P positive regulation of cell-substrate adhesion
GO:0010763 IEA:Ensembl P positive regulation of fibroblast migration
GO:0043123 IEA:Ensembl P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032024 IEA:Ensembl P positive regulation of insulin secretion
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0043410 IEA:Ensembl P positive regulation of MAPK cascade
GO:0070257 IEA:Ensembl P positive regulation of mucus secretion
GO:0032230 IEA:Ensembl P positive regulation of synaptic transmission, GABAergic
GO:0061178 IEA:Ensembl P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0050730 IEA:Ensembl P regulation of peptidyl-tyrosine phosphorylation
GO:0051209 IEA:Ensembl P release of sequestered calcium ion into cytosol
GO:0043278 IEA:Ensembl P response to morphine
GO:0035669 IEA:Ensembl P TRAM-dependent toll-like receptor 4 signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
hsa04022 cGMP-PKG signaling pathway
hsa04750 Inflammatory mediator regulation of TRP channels
hsa05206 MicroRNAs in cancer

Domain Information

InterPro Annotations

Accession Description
IPR000961 AGC-kinase, C-terminal
IPR000008 C2 domain
IPR020454 Diacylglycerol/phorbol-ester binding
IPR017441 Protein kinase, ATP binding site
IPR014376 Protein kinase C, delta/epsilon/eta/theta types
IPR027274 Protein kinase C, epsilon
IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain
IPR017892 Protein kinase, C-terminal
IPR000719 Protein kinase domain
IPR011009 Protein kinase-like domain
IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain
IPR008271 Serine/threonine-protein kinase, active site

UniProt Annotations

Entry Information

Gene Name
protein kinase C, epsilon
Protein Entry
KPCE_HUMAN
UniProt ID
Q02156
Species
Human

Comments

Comment Type Description
Catalytic Activity ATP + a protein = ADP + a phosphoprotein.
Enzyme Regulation Novel PKCs (PRKCD, PRKCE, PRKCH and PRKCQ) are calcium-insensitive, but activated by diacylglycerol (DAG) and phosphatidylserine.
Function Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration.
Similarity Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
Similarity Contains 1 C2 domain.
Similarity Contains AGC-kinase C-terminal domain.
Similarity Contains protein kinase domain.
Subcellular Location Cytoplasm . Cytoplasm, cytoskeleton . Cell membrane . Cytoplasm, perinuclear region . Nucleus . Note=Translocated to plasma membrane in epithelial cells stimulated by HGF. Associated with the Golgi at the perinuclear site in pre-passage fibroblasts. In passaging cells, translocated to the cell periphery. Translocated to the nucleus in PMA-treated cells.

Identical and Related Proteins

Unique RefSeq proteins for LMP001039 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4885563 RefSeq NP_005391 737 protein kinase C epsilon type

Identical Sequences to LMP001039 proteins

Reference Database Accession Length Protein Name
GI:4885563 GenBank AGV86232.1 737 Sequence 169 from patent US 8524673
GI:4885563 GenBank AHD73324.1 737 Sequence 10392 from patent US 8586006
GI:4885563 GenBank AHE12389.1 737 Sequence 4 from patent US 8598146
GI:4885563 GenBank AHE21101.1 737 Sequence 1 from patent US 8575307
GI:4885563 GenBank AIC49476.1 737 PRKCE, partial [synthetic construct]
GI:4885563 RefSeq XP_005264485.1 737 PREDICTED: protein kinase C epsilon type isoform X1 [Homo sapiens]

Related Sequences to LMP001039 proteins

Reference Database Accession Length Protein Name
GI:4885563 DBBJ BAG36574.1 737 unnamed protein product [Homo sapiens]
GI:4885563 GenBank EHH22097.1 736 hypothetical protein EGK_05295 [Macaca mulatta]
GI:4885563 GenBank AHE12399.1 737 Sequence 14 from patent US 8598146
GI:4885563 RefSeq XP_003309040.1 737 PREDICTED: LOW QUALITY PROTEIN: protein kinase C epsilon type [Pan troglodytes]
GI:4885563 RefSeq XP_003926800.1 737 PREDICTED: protein kinase C epsilon type isoform X1 [Saimiri boliviensis boliviensis]
GI:4885563 RefSeq XP_010362610.1 737 PREDICTED: protein kinase C epsilon type isoform X1 [Rhinopithecus roxellana]