Gene/Proteome Database (LMPD)

LMPD ID
LMP001040
Gene ID
10455
Species
Homo sapiens (Human)
Gene Name
enoyl-CoA delta isomerase 2
Gene Symbol
ECI2
Synonyms
ACBD2; DRS-1; DRS1; HCA88; PECI; dJ1013A10.3
Alternate Names
enoyl-CoA delta isomerase 2, mitochondrial; DBI-related protein 1; dodecenoyl-CoA isomerase; D3,D2-enoyl-CoA isomerase; renal carcinoma antigen NY-REN-1; delta(3),delta(2)-enoyl-CoA isomerase; peroxisomal D3,D2-enoyl-CoA isomerase; peroxisomal 3,2-trans-enoyl-CoA isomerase; acyl-Coenzyme A binding domain containing 2; diazepam-binding inhibitor-related protein 1; hepatocellular carcinoma-associated antigen 88
Chromosome
6
Map Location
6p24.3
EC Number
5.3.3.8
Summary
This gene encodes a member of the hydratase/isomerase superfamily. The protein encoded is a key mitochondrial enzyme involved in beta-oxidation of unsaturated fatty acids. It catalyzes the transformation of 3-cis and 3-trans-enoyl-CoA esters arising during the stepwise degradation of cis-, mono-, and polyunsaturated fatty acids to the 2-trans-enoyl-CoA intermediates. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Orthologs
View orthologs and multiple alignments for ECI2

Proteins

enoyl-CoA delta isomerase 2, mitochondrial isoform 1
Refseq ID NP_001159482
Protein GI 260275230
UniProt ID O75521
mRNA ID NM_001166010
Length 364
RefSeq Status VALIDATED
MNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL
enoyl-CoA delta isomerase 2, mitochondrial isoform 1
Refseq ID NP_006108
Protein GI 45643119
UniProt ID O75521
mRNA ID NM_006117
Length 364
RefSeq Status VALIDATED
Protein sequence is identical to GI:260275230 (mRNA isoform)
enoyl-CoA delta isomerase 2, mitochondrial isoform 2
Refseq ID NP_996667
Protein GI 260274832
UniProt ID O75521
mRNA ID NM_206836
Length 394
RefSeq Status VALIDATED
MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL
transit_peptide: 1..38 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (O75521.4) calculated_mol_wt: 4352 peptide sequence: MAMAYLAWRLARRSCPSSLQVTSFPVVQLHMNRTAMRA mat_peptide: 39..394 product: Enoyl-CoA delta isomerase 2, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O75521.4) calculated_mol_wt: 39251 peptide sequence: SQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL

Gene Information

Entrez Gene ID
10455
Gene Name
enoyl-CoA delta isomerase 2
Gene Symbol
ECI2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043231 IDA:HPA C intracellular membrane-bounded organelle
GO:0016020 IDA:UniProtKB C membrane
GO:0005739 IDA:LIFEdb C mitochondrion
GO:0005634 IDA:HPA C nucleus
GO:0005782 IDA:UniProtKB C peroxisomal matrix
GO:0005777 IEA:UniProtKB-KW C peroxisome
GO:0004165 IDA:UniProtKB F dodecenoyl-CoA delta-isomerase activity
GO:0000062 IEA:InterPro F fatty-acyl-CoA binding
GO:0005102 IPI:UniProtKB F receptor binding
GO:0009062 IDA:UniProtKB P fatty acid catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00071 Fatty acid degradation
ko00071 Fatty acid degradation
hsa04146 Peroxisome
ko04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site
IPR029045 ClpP/crotonase-like domain
IPR001753 Crotonase_core_superfam
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
enoyl-CoA delta isomerase 2
Protein Entry
ECI2_HUMAN
UniProt ID
O75521
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O75521-1; Sequence=Displayed; Name=2; IsoId=O75521-2; Sequence=VSP_037854;
Catalytic Activity (3Z)-dodec-3-enoyl-CoA = (2E)-dodec-2-enoyl- CoA.
Caution It is uncertain whether Met-1 or Met-3 is the initiator.
Function Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. Has a preference for 3-trans substrates (By similarity).
Sequence Caution Sequence=AAC19317.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAD34173.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAF66247.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH02668.3; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; Sequence=AAH16781.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH17474.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH33841.3; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=AAH34702.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; Sequence=BAG52068.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ;
Similarity Contains 1 ACB (acyl-CoA-binding) domain.
Similarity In the C-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
Subcellular Location Isoform 1: Mitochondrion .
Subcellular Location Isoform 2: Peroxisome matrix.
Tissue Specificity Abundant in heart, skeletal muscle and liver. Expressed in CD34(+) T-cells and CD34(+) bone marrow cells.

Identical and Related Proteins

Unique RefSeq proteins for LMP001040 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
260275230 RefSeq NP_001159482 364 enoyl-CoA delta isomerase 2, mitochondrial isoform 1
260274832 RefSeq NP_996667 394 enoyl-CoA delta isomerase 2, mitochondrial isoform 2

Identical Sequences to LMP001040 proteins

Reference Database Accession Length Protein Name
GI:260275230 DBBJ BAG52068.1 364 unnamed protein product [Homo sapiens]
GI:260275230 GenBank AAH17474.1 364 Peroxisomal D3,D2-enoyl-CoA isomerase [Homo sapiens]
GI:260275230 GenBank AAH16781.1 364 Peroxisomal D3,D2-enoyl-CoA isomerase [Homo sapiens]
GI:260275230 GenBank AAH33841.3 364 Peroxisomal D3,D2-enoyl-CoA isomerase [Homo sapiens]
GI:260274832 GenBank ABC13664.1 394 Sequence 67 from patent US 6964849
GI:260274832 GenBank ABE19187.1 394 Sequence 67 from patent US 6991901
GI:260274832 GenBank ABL57284.1 394 Sequence 67 from patent US 7141549
GI:260274832 GenBank ACE86756.1 394 peroxisomal D3,D2-enoyl-CoA isomerase protein, partial [synthetic construct]
GI:260274832 GenBank ACE87444.1 394 peroxisomal D3,D2-enoyl-CoA isomerase protein [synthetic construct]
GI:260275230 GenBank AHD73880.1 364 Sequence 12338 from patent US 8586006
GI:260275230 GenBank AIC50633.1 364 ECI2, partial [synthetic construct]
GI:260274832 SwissProt O75521.4 394 RecName: Full=Enoyl-CoA delta isomerase 2, mitochondrial; AltName: Full=DRS-1; AltName: Full=Delta(3),delta(2)-enoyl-CoA isomerase; Short=D3,D2-enoyl-CoA isomerase; AltName: Full=Diazepam-binding inhibitor-related protein 1; Short=DBI-related protein 1; AltName: Full=Dodecenoyl-CoA isomerase; AltName: Full=Hepatocellular carcinoma-associated antigen 88; AltName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase; Short=pECI; AltName: Full=Renal carcinoma antigen NY-REN-1; Flags: Precursor [Homo sapiens]

Related Sequences to LMP001040 proteins

Reference Database Accession Length Protein Name
GI:260274832 GenBank AAP36349.1 395 Homo sapiens peroxisomal D3,D2-enoyl-CoA isomerase, partial [synthetic construct]
GI:260274832 GenBank AAX29010.1 395 peroxisomal D3D2-enoyl-CoA isomerase, partial [synthetic construct]
GI:260275230 GenBank ABC13664.1 394 Sequence 67 from patent US 6964849
GI:260275230 GenBank ABE19187.1 394 Sequence 67 from patent US 6991901
GI:260274832 GenBank ABL57283.1 394 Sequence 66 from patent US 7141549
GI:260275230 GenBank ABL57284.1 394 Sequence 67 from patent US 7141549
GI:260274832 GenBank EAW55163.1 394 peroxisomal D3,D2-enoyl-CoA isomerase, isoform CRA_e [Homo sapiens]
GI:260275230 GenBank ACE86756.1 394 peroxisomal D3,D2-enoyl-CoA isomerase protein, partial [synthetic construct]
GI:260274832 GenBank ADA20727.1 394 Sequence 2551 from patent US 7608413
GI:260274832 GenBank AEN36623.1 394 Sequence 2551 from patent US 7998689
GI:260275230 RefSeq NP_996667.2 394 enoyl-CoA delta isomerase 2, mitochondrial isoform 2 [Homo sapiens]
GI:260275230 SwissProt O75521.4 394 RecName: Full=Enoyl-CoA delta isomerase 2, mitochondrial; AltName: Full=DRS-1; AltName: Full=Delta(3),delta(2)-enoyl-CoA isomerase; Short=D3,D2-enoyl-CoA isomerase; AltName: Full=Diazepam-binding inhibitor-related protein 1; Short=DBI-related protein 1; AltName: Full=Dodecenoyl-CoA isomerase; AltName: Full=Hepatocellular carcinoma-associated antigen 88; AltName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase; Short=pECI; AltName: Full=Renal carcinoma antigen NY-REN-1; Flags: Precursor [Homo sapiens]