Gene/Proteome Database (LMPD)
LMPD ID
LMP001079
Gene ID
Species
Homo sapiens (Human)
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Synonyms
CGI-63; FASN2B; NRBF1
Alternate Names
trans-2-enoyl-CoA reductase, mitochondrial; nuclear receptor binding factor 1; mitochondrial 2-enoyl thioester reductase; homolog of yeast 2-enoyl thioester reductase
Chromosome
1
Map Location
1p35.3
EC Number
1.3.1.38
Proteins
trans-2-enoyl-CoA reductase, mitochondrial isoform a | |
---|---|
Refseq ID | NP_057095 |
Protein GI | 544346134 |
UniProt ID | Q9BV79 |
mRNA ID | NM_016011 |
Length | 373 |
RefSeq Status | VALIDATED |
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM | |
transit_peptide: 1..53 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9BV79.2) calculated_mol_wt: 5778 peptide sequence: MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGD mat_peptide: 54..373 product: Trans-2-enoyl-CoA reductase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9BV79.2) calculated_mol_wt: 34668 peptide sequence: PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM |
trans-2-enoyl-CoA reductase, mitochondrial isoform b | |
---|---|
Refseq ID | NP_001019903 |
Protein GI | 544346114 |
UniProt ID | Q9BV79 |
mRNA ID | NM_001024732 |
Length | 297 |
RefSeq Status | VALIDATED |
MLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM |
Gene Information
Entrez Gene ID
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:UniProtKB | C | mitochondrion |
GO:0019166 | IDA:UniProtKB | F | trans-2-enoyl-CoA reductase (NADPH) activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0006631 | IDA:UniProtKB | P | fatty acid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Protein Entry
MECR_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BV79-1; Sequence=Displayed; Name=2; IsoId=Q9BV79-2; Sequence=VSP_041131; Note=No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: KM=37 uM for trans-2-hexenoyl-CoA {ECO |
Catalytic Activity | Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH. {ECO |
Function | Oxidoreductase with a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2- decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16). May play a role in mitochondrial fatty acid synthesis. |
Sequence Caution | Sequence=AAD34058.1; Type=Frameshift; Positions=14, 19; Evidence= ; |
Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
Subcellular Location | Mitochondrion . |
Subunit | Homodimer. {ECO |
Tissue Specificity | Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001079 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
544346134 | RefSeq | NP_057095 | 373 | trans-2-enoyl-CoA reductase, mitochondrial isoform a |
544346114 | RefSeq | NP_001019903 | 297 | trans-2-enoyl-CoA reductase, mitochondrial isoform b |
Identical Sequences to LMP001079 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:544346114 | DBBJ | BAG52984.1 | 297 | unnamed protein product [Homo sapiens] |
GI:544346134 | DBBJ | BAI46777.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, partial [synthetic construct] |
GI:544346134 | GenBank | AAH01419.1 | 373 | Mitochondrial trans-2-enoyl-CoA reductase [Homo sapiens] |
GI:544346134 | GenBank | EAX07654.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, isoform CRA_b [Homo sapiens] |
GI:544346114 | GenBank | EAX07655.1 | 297 | mitochondrial trans-2-enoyl-CoA reductase, isoform CRA_c [Homo sapiens] |
GI:544346134 | GenBank | ADZ15732.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, partial [synthetic construct] |
GI:544346134 | GenBank | AIC56381.1 | 373 | MECR, partial [synthetic construct] |
Related Sequences to LMP001079 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:544346114 | DBBJ | BAI46777.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, partial [synthetic construct] |
GI:544346134 | EMBL | CAG32984.1 | 373 | CGI-63 [Homo sapiens] |
GI:544346114 | GenBank | AAD34058.1 | 373 | CGI-63 protein [Homo sapiens] |
GI:544346114 | GenBank | AAH01419.1 | 373 | Mitochondrial trans-2-enoyl-CoA reductase [Homo sapiens] |
GI:544346114 | GenBank | ADZ15732.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, partial [synthetic construct] |
GI:544346134 | GenBank | EHH49700.1 | 373 | hypothetical protein EGM_00407 [Macaca fascicularis] |
GI:544346114 | GenBank | AIC56381.1 | 373 | MECR, partial [synthetic construct] |
GI:544346134 | RefSeq | XP_001156115.1 | 373 | PREDICTED: trans-2-enoyl-CoA reductase, mitochondrial isoform X2 [Pan troglodytes] |
GI:544346134 | RefSeq | XP_003828155.1 | 373 | PREDICTED: trans-2-enoyl-CoA reductase, mitochondrial isoform X1 [Pan paniscus] |
GI:544346134 | RefSeq | XP_004025368.1 | 373 | PREDICTED: trans-2-enoyl-CoA reductase, mitochondrial isoform 1 [Gorilla gorilla gorilla] |
GI:544346114 | RefSeq | NP_057095.3 | 373 | trans-2-enoyl-CoA reductase, mitochondrial isoform a [Homo sapiens] |
GI:544346134 | SwissProt | Q9BV79.2 | 373 | RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=HsNrbf-1; Short=NRBF-1; Flags: Precursor [Homo sapiens] |