Gene/Proteome Database (LMPD)

LMPD ID
LMP001098
Gene ID
19662
Species
Mus musculus (Mouse)
Gene Name
retinol binding protein 4, plasma
Gene Symbol
Rbp4
Synonyms
Rbp-4
Chromosome
19
Map Location
19 D1|19 32.75 cM

Proteins

retinol-binding protein 4 isoform 1
Refseq ID NP_001152959
Protein GI 226958688
UniProt ID Q00724
mRNA ID NM_001159487
Length 245
RefSeq Status VALIDATED
MDPLGWRVWLHRDHPERSSEHRRRGTARLTEGPRVRSGGRLRGEMEWVWALVLLAALGGGSAERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
retinol-binding protein 4 isoform 2 precursor
Refseq ID NP_035385
Protein GI 33859612
UniProt ID Q00724
mRNA ID NM_011255
Length 201
RefSeq Status VALIDATED
MEWVWALVLLAALGGGSAERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1844 peptide sequence: MEWVWALVLLAALGGGSA mat_peptide: 19..201 product: Retinol-binding protein 4 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q00724.2) calculated_mol_wt: 21380 peptide sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Gene Information

Entrez Gene ID
19662
Gene Name
retinol binding protein 4, plasma
Gene Symbol
Rbp4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0043234 IEA:Ensembl C protein complex
GO:0019841 IDA:MGI F retinol binding
GO:0034632 IMP:MGI F retinol transporter activity
GO:0050908 IMP:MGI P detection of light stimulus involved in visual perception
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0030277 IEA:Ensembl P maintenance of gastrointestinal epithelium
GO:0008584 IMP:MGI P male gonad development
GO:0032024 IEA:Ensembl P positive regulation of insulin secretion
GO:0045471 IEA:Ensembl P response to ethanol
GO:0032868 IMP:MGI P response to insulin
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0060041 IMP:MGI P retina development in camera-type eye
GO:0042574 IMP:MGI P retinal metabolic process
GO:0042572 IGI:MGI P retinol metabolic process
GO:0034633 IMP:MGI P retinol transport
GO:0007283 IMP:MGI P spermatogenesis

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR002345 Lipocalin
IPR022271 Lipocalin, ApoD type
IPR000566 Lipocalin/cytosolic fatty-acid binding domain
IPR022272 Lipocalin family conserved site
IPR002449 Retinol binding protein/Purpurin

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 4, plasma
Protein Entry
RET4_MOUSE
UniProt ID
Q00724
Species
Mouse

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the calycin superfamily. Lipocalin family.

Identical and Related Proteins

Unique RefSeq proteins for LMP001098 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
226958688 RefSeq NP_001152959 245 retinol-binding protein 4 isoform 1
33859612 RefSeq NP_035385 201 retinol-binding protein 4 isoform 2 precursor

Identical Sequences to LMP001098 proteins

Reference Database Accession Length Protein Name
GI:33859612 DBBJ BAB25881.1 201 unnamed protein product [Mus musculus]
GI:33859612 DBBJ BAD16678.1 201 retinol binding protein 4 [Mus musculus]
GI:33859612 GenBank AAH31809.1 201 Rbp4 protein [Mus musculus]
GI:33859612 GenBank AAH93529.1 201 Retinol binding protein 4, plasma [Mus musculus]
GI:33859612 GenBank AED17211.1 201 Sequence 525 from patent US 7879544
GI:33859612 SwissProt Q00724.2 201 RecName: Full=Retinol-binding protein 4; AltName: Full=Plasma retinol-binding protein; Short=PRBP; Short=RBP; Flags: Precursor [Mus musculus]

Related Sequences to LMP001098 proteins

Reference Database Accession Length Protein Name
GI:33859612 GenBank AAA42018.1 201 retinol-binding protein [Rattus norvegicus]
GI:33859612 GenBank AAQ31634.1 400 Sequence 37 from patent US 6566073
GI:33859612 GenBank EDM13210.1 201 retinol binding protein 4, plasma, isoform CRA_a [Rattus norvegicus]
GI:33859612 GenBank AAI67099.1 201 Retinol binding protein 4, plasma [Rattus norvegicus]
GI:226958688 GenBank ERE77494.1 201 retinol-binding protein 4 [Cricetulus griseus]
GI:33859612 RefSeq NP_037294.1 201 retinol-binding protein 4 precursor [Rattus norvegicus]
GI:226958688 RefSeq XP_003500765.1 263 PREDICTED: retinol-binding protein 4 isoform X1 [Cricetulus griseus]
GI:226958688 RefSeq XP_005063693.1 201 PREDICTED: retinol-binding protein 4 isoform X1 [Mesocricetus auratus]
GI:226958688 RefSeq XP_005063694.1 201 PREDICTED: retinol-binding protein 4 isoform X2 [Mesocricetus auratus]
GI:226958688 RefSeq XP_006976696.1 201 PREDICTED: retinol-binding protein 4 [Peromyscus maniculatus bairdii]
GI:226958688 RefSeq XP_007614606.1 201 PREDICTED: retinol-binding protein 4 isoform X2 [Cricetulus griseus]
GI:33859612 SwissProt P04916.1 201 RecName: Full=Retinol-binding protein 4; AltName: Full=Plasma retinol-binding protein; Short=PRBP; Short=RBP; Flags: Precursor [Rattus norvegicus]