Gene/Proteome Database (LMPD)

LMPD ID
LMP001143
Gene ID
11690
Species
Mus musculus (Mouse)
Gene Name
arachidonate 5-lipoxygenase activating protein
Gene Symbol
Alox5ap
Synonyms
Flap
Alternate Names
arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; arachidonate 5 lipoxygenase activating protein
Chromosome
5
Map Location
5 G3|5

Proteins

arachidonate 5-lipoxygenase-activating protein precursor
Refseq ID NP_033793
Protein GI 33563242
UniProt ID P30355
mRNA ID NM_009663
Length 161
RefSeq Status PROVISIONAL
MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSFAGILNHYLIFFFGSDFENYIRTVSTTISPLLLIP
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2426 peptide sequence: MDQEAVGNVVLLALVTLISVVQN

Gene Information

Entrez Gene ID
11690
Gene Name
arachidonate 5-lipoxygenase activating protein
Gene Symbol
Alox5ap
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0005783 IBA:RefGenome C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0031965 ISS:UniProtKB C nuclear membrane
GO:0005634 IDA:MGI C nucleus
GO:0050544 ISS:UniProtKB F arachidonic acid binding
GO:0008047 IEA:InterPro F enzyme activator activity
GO:0071277 IEA:Ensembl P cellular response to calcium ion
GO:0019370 IDA:MGI P leukotriene biosynthetic process
GO:0002540 IMP:MGI P leukotriene production involved in inflammatory response
GO:0002675 IEA:Ensembl P positive regulation of acute inflammatory response
GO:0070207 IEA:Ensembl P protein homotrimerization

REACTOME Pathway Links

REACTOME Pathway ID Description
5893606 Synthesis of 5-eicosatetraenoic acids
5893593 Synthesis of Leukotrienes (LT) and Eoxins (EX)
5894063 Synthesis of Lipoxins (LX)

Domain Information

InterPro Annotations

Accession Description
IPR001446 5-lipoxygenase-activating protein
IPR018295 FLAP/GST2/LTC4S, conserved site
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
arachidonate 5-lipoxygenase activating protein
Protein Entry
AL5AP_MOUSE
UniProt ID
P30355
Species
Mouse

Comments

Comment Type Description
Domain The C-terminal part after residue 140 is mostly disordered. {ECO:0000250}.
Function Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes (By similarity). unstructured (By similarity). {ECO:0000250}.
Similarity Belongs to the MAPEG family. {ECO:0000305}.
Subcellular Location Nucleus membrane {ECO:0000269|PubMed:19075240}; Multi-pass membrane protein {ECO:0000269|PubMed:19075240}. Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Homotrimer. Interacts with LTC4S and ALOX5. {ECO:0000269|PubMed:19075240}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001143 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
33563242 RefSeq NP_033793 161 arachidonate 5-lipoxygenase-activating protein precursor

Identical Sequences to LMP001143 proteins

Reference Database Accession Length Protein Name
GI:33563242 DBBJ BAB23117.1 161 unnamed protein product [Mus musculus]
GI:33563242 GenBank AAH26209.1 161 Arachidonate 5-lipoxygenase activating protein [Mus musculus]
GI:33563242 SwissProt P30355.2 161 RecName: Full=Arachidonate 5-lipoxygenase-activating protein; AltName: Full=FLAP; AltName: Full=MK-886-binding protein [Mus musculus]

Related Sequences to LMP001143 proteins

Reference Database Accession Length Protein Name
GI:33563242 GenBank AAH86593.1 161 Arachidonate 5-lipoxygenase activating protein [Rattus norvegicus]
GI:33563242 GenBank EDL05864.1 166 arachidonate 5-lipoxygenase activating protein, partial [Mus musculus]
GI:33563242 GenBank EDL89525.1 161 arachidonate 5-lipoxygenase activating protein [Rattus norvegicus]
GI:33563242 GenBank AEK13630.1 161 Sequence 42 from patent US 7972785
GI:33563242 PRF - 161 lipoxygenase activating protein [Rattus norvegicus]
GI:33563242 RefSeq NP_058956.1 161 arachidonate 5-lipoxygenase-activating protein [Rattus norvegicus]