Gene/Proteome Database (LMPD)

LMPD ID
LMP001193
Gene ID
8260
Species
Homo sapiens (Human)
Gene Name
N(alpha)-acetyltransferase 10, NatA catalytic subunit
Gene Symbol
NAA10
Synonyms
ARD1; ARD1A; ARD1P; DXS707; MCOPS1; NATD; TE2
Chromosome
X
Map Location
Xq28
EC Number
2.3.1.-
Summary
N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Orthologs
View orthologs and multiple alignments for NAA10

Proteins

N-alpha-acetyltransferase 10 isoform 1
Refseq ID NP_003482
Protein GI 10835057
UniProt ID P41227
mRNA ID NM_003491
Length 235
RefSeq Status REVIEWED
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
N-alpha-acetyltransferase 10 isoform 2
Refseq ID NP_001243048
Protein GI 371121601
UniProt ID P41227
mRNA ID NM_001256119
Length 220
RefSeq Status REVIEWED
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKRISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
N-alpha-acetyltransferase 10 isoform 3
Refseq ID NP_001243049
Protein GI 371121838
UniProt ID B7Z9N2
mRNA ID NM_001256120
Length 229
RefSeq Status REVIEWED
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

Gene Information

Entrez Gene ID
8260
Gene Name
N(alpha)-acetyltransferase 10, NatA catalytic subunit
Gene Symbol
NAA10
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031415 IDA:UniProt C NatA complex
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0005622 IDA:LIFEdb C intracellular
GO:0016020 IDA:UniProtKB C membrane
GO:0005730 IDA:HPA C nucleolus
GO:0005634 IDA:UniProtKB C nucleus
GO:0008080 TAS:ProtInc F N-acetyltransferase activity
GO:0004596 IEA:UniProtKB-EC F peptide alpha-N-acetyltransferase activity
GO:0006323 TAS:ProtInc P DNA packaging
GO:0006474 IDA:UniProtKB P N-terminal protein amino acid acetylation
GO:0006475 TAS:ProtInc P internal protein amino acid acetylation

Domain Information

InterPro Annotations

Accession Description
IPR016181 Acyl-CoA N-acyltransferase
IPR000182 GNAT domain

UniProt Annotations

Entry Information

Gene Name
N(alpha)-acetyltransferase 10, NatA catalytic subunit
Protein Entry
NAA10_HUMAN
UniProt ID
P41227
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P41227-1; Sequence=Displayed; Name=2; IsoId=P41227-2; Sequence=VSP_046205, VSP_046206;
Catalytic Activity Acetyl-CoA + peptide = N(alpha)-acetylpeptide + CoA.
Disease Microphthalmia, syndromic, 1 (MCOPS1) [MIM
Disease N-terminal acetyltransferase deficiency (NATD) [MIM
Function Catalytic subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. The NAT activity may be important for vascular, hematopoietic and neuronal growth and development. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration. Acetylates, and stabilizes TSC2, thereby repressing mTOR activity and suppressing cancer development. {ECO
Interaction Q15052:ARHGEF6; NbExp=3; IntAct=EBI-747693, EBI-1642523; Q14155:ARHGEF7; NbExp=3; IntAct=EBI-747693, EBI-717515; O55043:Arhgef7 (xeno); NbExp=3; IntAct=EBI-747693, EBI-3649585; Q9GZZ1:NAA50; NbExp=2; IntAct=EBI-747693, EBI-1052523;
Ptm Cleaved by caspases during apoptosis.
Ptm Phosphorylation by IKBKB/IKKB at Ser-209 promotes its proteasome-mediated degradation. {ECO
Similarity Belongs to the acetyltransferase family. ARD1 subfamily.
Similarity Contains 1 N-acetyltransferase domain.
Subcellular Location Cytoplasm. Nucleus. Note=According to PubMed:12464182 it is cytoplasmic. According to PubMed:15496142, it is nuclear and cytoplasmic. Also present in the free cytosolic and cytoskeleton-bound polysomes.
Subunit Component of the N-terminal acetyltransferase A (NatA) complex composed of NAA10 and NAA15 or NAA16. Interacts with HIF1A (via its ODD domain); the interaction increases HIF1A protein stability during normoxia, an down-regulates it when induced by hypoxia. Interacts with NAA50 and with the ribosome. Binds to MYLK. Associates with HYPK when in complex with NAA15. Interacts (via its C-terminal domain) with TSC2, leading to its acetylation. {ECO
Tissue Specificity Ubiquitous.

Identical and Related Proteins

Unique RefSeq proteins for LMP001193 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10835057 RefSeq NP_003482 235 N-alpha-acetyltransferase 10 isoform 1
371121601 RefSeq NP_001243048 220 N-alpha-acetyltransferase 10 isoform 2
371121838 RefSeq NP_001243049 229 N-alpha-acetyltransferase 10 isoform 3

Identical Sequences to LMP001193 proteins

Reference Database Accession Length Protein Name
GI:371121601 GenBank EAW72774.1 220 ARD1 homolog A, N-acetyltransferase (S. cerevisiae), isoform CRA_b [Homo sapiens]
GI:10835057 GenBank AIC50068.1 235 NAA10, partial [synthetic construct]
GI:10835057 RefSeq XP_004065150.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform 2 [Gorilla gorilla gorilla]
GI:10835057 RefSeq XP_004065151.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform 3 [Gorilla gorilla gorilla]
GI:371121838 RefSeq XP_004065152.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform 4 [Gorilla gorilla gorilla]
GI:371121601 RefSeq XP_004065153.1 220 PREDICTED: N-alpha-acetyltransferase 10 isoform 5 [Gorilla gorilla gorilla]
GI:10835057 RefSeq XP_005595009.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform X3 [Macaca fascicularis]
GI:371121838 RefSeq XP_005595010.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform X4 [Macaca fascicularis]
GI:371121601 RefSeq XP_005595011.1 220 PREDICTED: N-alpha-acetyltransferase 10 isoform X5 [Macaca fascicularis]
GI:10835057 RefSeq XP_007991305.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform X1 [Chlorocebus sabaeus]
GI:10835057 RefSeq XP_010360033.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform X1 [Rhinopithecus roxellana]

Related Sequences to LMP001193 proteins

Reference Database Accession Length Protein Name
GI:10835057 GenBank ABX10977.1 235 ARD1 homolog A, N-acetyltransferase (predicted) [Papio anubis]
GI:10835057 GenBank ACM84995.1 250 Sequence 10493 from patent US 6812339
GI:371121601 GenBank JAB02712.1 220 N-alpha-acetyltransferase 10 isoform 2 [Callithrix jacchus]
GI:371121601 GenBank JAB44219.1 220 N-alpha-acetyltransferase 10 isoform 2 [Callithrix jacchus]
GI:10835057 RefSeq NP_001162264.1 235 N-alpha-acetyltransferase 10 [Papio anubis]
GI:10835057 RefSeq XP_003279353.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform 1 [Nomascus leucogenys]
GI:10835057 RefSeq XP_003279354.1 235 PREDICTED: N-alpha-acetyltransferase 10 isoform 2 [Nomascus leucogenys]
GI:371121838 RefSeq XP_003802596.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform 3 [Otolemur garnettii]
GI:10835057 RefSeq XP_004092609.1 235 PREDICTED: N-alpha-acetyltransferase 10 [Nomascus leucogenys]
GI:371121838 RefSeq XP_004092610.1 229 PREDICTED: N-alpha-acetyltransferase 10 [Nomascus leucogenys]
GI:371121601 RefSeq XP_004092611.1 220 PREDICTED: N-alpha-acetyltransferase 10 [Nomascus leucogenys]
GI:371121838 RefSeq XP_004443375.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform 2 [Ceratotherium simum simum]
GI:371121601 RefSeq XP_004443376.1 220 PREDICTED: N-alpha-acetyltransferase 10 isoform 3 [Ceratotherium simum simum]
GI:371121838 RefSeq XP_005340678.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform X2 [Ictidomys tridecemlineatus]
GI:371121601 RefSeq XP_005340679.1 220 PREDICTED: N-alpha-acetyltransferase 10 isoform X3 [Ictidomys tridecemlineatus]
GI:371121838 RefSeq XP_005614687.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform X2 [Equus caballus]
GI:371121601 RefSeq XP_005614688.1 220 PREDICTED: N-alpha-acetyltransferase 10 isoform X3 [Equus caballus]
GI:371121838 RefSeq XP_008988335.1 229 PREDICTED: N-alpha-acetyltransferase 10 isoform X2 [Callithrix jacchus]