Gene/Proteome Database (LMPD)
LMPD ID
LMP001230
Gene ID
Species
Homo sapiens (Human)
Gene Name
lysophosphatidylglycerol acyltransferase 1
Gene Symbol
Synonyms
FAM34A; FAM34A1; NET8
Alternate Names
acyl-CoA:lysophosphatidylglycerol acyltransferase 1; family with sequence similarity 34, member A
Chromosome
1
Map Location
1q32
EC Number
2.3.1.-
Summary
Acyl-CoA:lysophosphatidylglycerol (LPG) acyltransferase catalyzes the reacylation of LPG to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin (Yang et al., 2004 [PubMed 15485873]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| acyl-CoA:lysophosphatidylglycerol acyltransferase 1 | |
|---|---|
| Refseq ID | NP_055688 |
| Protein GI | 7661996 |
| UniProt ID | Q92604 |
| mRNA ID | NM_014873 |
| Length | 370 |
| RefSeq Status | VALIDATED |
| MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidylglycerol acyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0016746 | IEA:UniProtKB-KW | F | transferase activity, transferring acyl groups |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121324 | Acyl chain remodelling of PG |
| REACT_121401 | Glycerophospholipid biosynthesis |
| REACT_120870 | Phospholipid metabolism |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
lysophosphatidylglycerol acyltransferase 1
Protein Entry
LGAT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. |
| Function | Lysophoshatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor. |
| Sequence Caution | Sequence=BAA13196.2; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in liver and placenta. Also expressed in peripheral blood, lung, kidney and brain. Detected at lower levels in colon. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001230 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7661996 | RefSeq | NP_055688 | 370 | acyl-CoA:lysophosphatidylglycerol acyltransferase 1 |
Identical Sequences to LMP001230 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7661996 | DBBJ | BAG09654.1 | 370 | acyl-CoA:lysophosphatidylglycerol acyltransferase 1, partial [synthetic construct] |
| GI:7661996 | GenBank | EAW93408.1 | 370 | lysophosphatidylglycerol acyltransferase 1, isoform CRA_a [Homo sapiens] |
| GI:7661996 | GenBank | ACW04080.1 | 370 | Sequence 67 from patent US 7553492 |
| GI:7661996 | GenBank | AFD52005.1 | 370 | Sequence 67 from patent US 8133877 |
| GI:7661996 | GenBank | AIC50462.1 | 370 | LPGAT1, partial [synthetic construct] |
| GI:7661996 | RefSeq | XP_005273421.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X3 [Homo sapiens] |
Related Sequences to LMP001230 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7661996 | DBBJ | BAA13196.2 | 391 | KIAA0205, partial [Homo sapiens] |
| GI:7661996 | RefSeq | XP_004028407.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:7661996 | RefSeq | XP_004028408.1 | 370 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:7661996 | RefSeq | XP_005273419.1 | 403 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X1 [Homo sapiens] |
| GI:7661996 | RefSeq | XP_005273420.1 | 396 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X2 [Homo sapiens] |
| GI:7661996 | RefSeq | XP_006711758.1 | 388 | PREDICTED: acyl-CoA:lysophosphatidylglycerol acyltransferase 1 isoform X4 [Homo sapiens] |