Gene/Proteome Database (LMPD)
LMPD ID
LMP001246
Gene ID
Species
Homo sapiens (Human)
Gene Name
retinoic acid receptor, gamma
Gene Symbol
Synonyms
NR1B3; RARC
Chromosome
12
Map Location
12q13
Summary
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Orthologs
Proteins
retinoic acid receptor gamma isoform 1 | |
---|---|
Refseq ID | NP_000957 |
Protein GI | 4506423 |
UniProt ID | P13631 |
mRNA ID | NM_000966 |
Length | 454 |
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA |
retinoic acid receptor gamma isoform 2 | |
---|---|
Refseq ID | NP_001036193 |
Protein GI | 112181200 |
UniProt ID | P13631 |
mRNA ID | NM_001042728 |
Length | 443 |
MYDCMETFAPGPRRLYGAAGPGAGLLRRATGGSCFAGLESFAWPQPASLQSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA |
retinoic acid receptor gamma isoform 3 | |
---|---|
Refseq ID | NP_001230661 |
Protein GI | 344030240 |
UniProt ID | P13631 |
mRNA ID | NM_001243732 |
Length | 432 |
MLALPLPPCWSGAPPGEEGESAAGPWCFQHPVSLQAGSRCTTVWKRLPRVRDGCTGRPGPGPACCAEPPAAPVSPDLNLLPGRNPPACNGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA |
retinoic acid receptor gamma isoform 4 | |
---|---|
Refseq ID | NP_001230659 |
Protein GI | 344030235 |
UniProt ID | P13631 |
mRNA ID | NM_001243730 |
Length | 382 |
MVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA |
retinoic acid receptor gamma isoform 5 | |
---|---|
Refseq ID | NP_001230660 |
Protein GI | 344030237 |
UniProt ID | B7Z4B4 |
mRNA ID | NM_001243731 |
Length | 333 |
MVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | NAS:BHF-UCL | C | integral component of membrane |
GO:0000790 | IEA:Ensembl | C | nuclear chromatin |
GO:0005654 | TAS:Reactome | C | nucleoplasm |
GO:0005634 | IDA:UniProtKB | C | nucleus |
GO:0005667 | ISS:BHF-UCL | C | transcription factor complex |
GO:0003677 | ISS:BHF-UCL | F | DNA binding |
GO:0003708 | IEA:Ensembl | F | retinoic acid receptor activity |
GO:0046965 | ISS:BHF-UCL | F | retinoid X receptor binding |
GO:0000977 | IEA:Ensembl | F | RNA polymerase II regulatory region sequence-specific DNA binding |
GO:0003700 | ISS:BHF-UCL | F | sequence-specific DNA binding transcription factor activity |
GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0009952 | IEA:Ensembl | P | anterior/posterior pattern specification |
GO:0060070 | TAS:BHF-UCL | P | canonical Wnt signaling pathway |
GO:0071300 | IEA:Ensembl | P | cellular response to retinoic acid |
GO:0031076 | IEA:Ensembl | P | embryonic camera-type eye development |
GO:0048048 | ISS:BHF-UCL | P | embryonic eye morphogenesis |
GO:0035116 | ISS:BHF-UCL | P | embryonic hindlimb morphogenesis |
GO:0060324 | IEA:Ensembl | P | face development |
GO:0010467 | TAS:Reactome | P | gene expression |
GO:0002068 | IEA:Ensembl | P | glandular epithelial cell development |
GO:0003430 | IEA:Ensembl | P | growth plate cartilage chondrocyte growth |
GO:0070384 | IEA:Ensembl | P | Harderian gland development |
GO:0035264 | IEA:Ensembl | P | multicellular organism growth |
GO:0043066 | IEA:Ensembl | P | negative regulation of apoptotic process |
GO:0061037 | IEA:Ensembl | P | negative regulation of cartilage development |
GO:0008285 | ISS:BHF-UCL | P | negative regulation of cell proliferation |
GO:0032331 | IEA:Ensembl | P | negative regulation of chondrocyte differentiation |
GO:0000122 | ISS:BHF-UCL | P | negative regulation of transcription from RNA polymerase II promoter |
GO:0001843 | IEA:Ensembl | P | neural tube closure |
GO:0043065 | ISS:BHF-UCL | P | positive regulation of apoptotic process |
GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
GO:0043068 | ISS:BHF-UCL | P | positive regulation of programmed cell death |
GO:0045944 | ISS:BHF-UCL | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0060740 | IEA:Ensembl | P | prostate gland epithelium morphogenesis |
GO:0008361 | TAS:BHF-UCL | P | regulation of cell size |
GO:0031641 | IEA:Ensembl | P | regulation of myelination |
GO:0032526 | IDA:BHF-UCL | P | response to retinoic acid |
GO:0003406 | IEA:Ensembl | P | retinal pigment epithelium development |
GO:0048384 | IDA:BHF-UCL | P | retinoic acid receptor signaling pathway |
GO:0060534 | IEA:Ensembl | P | trachea cartilage development |
GO:0006367 | TAS:Reactome | P | transcription initiation from RNA polymerase II promoter |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Comment=Isoforms differ only in their N-terminal regions.; Name=1; IsoId=P13631-1; Sequence=Displayed; Name=2; IsoId=P13631-2; Sequence=VSP_031080; Name=3; IsoId=P13631-3; Sequence=VSP_044777; Note=No experimental confirmation available.; Name=4; IsoId=P13631-4; Sequence=VSP_044776; Note=No experimental confirmation available.; |
Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function (By similarity) |
Interaction | O60504-2:SORBS3; NbExp=2; IntAct=EBI-2568901, EBI-1222956; |
Sequence Caution | Sequence=CAA40548.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily |
Similarity | Contains 1 nuclear receptor DNA-binding domain |
Subcellular Location | Nucleus. |
Subunit | Homodimer. Heterodimer with a RXR molecule. Binds DNA preferentially as a RAR/RXR heterodimer. Forms a complex with PUS1 and the SRA1 RNA in the nucleus |
Web Resource | Name=Wikipedia; Note=Retinoic acid receptor entry; URL="http://en.wikipedia.org/wiki/Retinoic_acid_receptor"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001246 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4506423 | RefSeq | NP_000957 | 454 | retinoic acid receptor gamma isoform 1 |
112181200 | RefSeq | NP_001036193 | 443 | retinoic acid receptor gamma isoform 2 |
344030240 | RefSeq | NP_001230661 | 432 | retinoic acid receptor gamma isoform 3 |
344030235 | RefSeq | NP_001230659 | 382 | retinoic acid receptor gamma isoform 4 |
344030237 | RefSeq | NP_001230660 | 333 | retinoic acid receptor gamma isoform 5 |
Identical Sequences to LMP001246 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP001246 proteins
Reference | Database | Accession | Length | Protein Name |
---|