Gene/Proteome Database (LMPD)

LMPD ID
LMP001246
Gene ID
5916
Species
Homo sapiens (Human)
Gene Name
retinoic acid receptor, gamma
Gene Symbol
RARG
Synonyms
NR1B3; RARC
Chromosome
12
Map Location
12q13
Summary
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Orthologs
View orthologs and multiple alignments for RARG

Proteins

retinoic acid receptor gamma isoform 1
Refseq ID NP_000957
Protein GI 4506423
UniProt ID P13631
mRNA ID NM_000966
Length 454
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
retinoic acid receptor gamma isoform 2
Refseq ID NP_001036193
Protein GI 112181200
UniProt ID P13631
mRNA ID NM_001042728
Length 443
MYDCMETFAPGPRRLYGAAGPGAGLLRRATGGSCFAGLESFAWPQPASLQSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
retinoic acid receptor gamma isoform 3
Refseq ID NP_001230661
Protein GI 344030240
UniProt ID P13631
mRNA ID NM_001243732
Length 432
MLALPLPPCWSGAPPGEEGESAAGPWCFQHPVSLQAGSRCTTVWKRLPRVRDGCTGRPGPGPACCAEPPAAPVSPDLNLLPGRNPPACNGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
retinoic acid receptor gamma isoform 4
Refseq ID NP_001230659
Protein GI 344030235
UniProt ID P13631
mRNA ID NM_001243730
Length 382
MVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
retinoic acid receptor gamma isoform 5
Refseq ID NP_001230660
Protein GI 344030237
UniProt ID B7Z4B4
mRNA ID NM_001243731
Length 333
MVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

Gene Information

Entrez Gene ID
5916
Gene Name
retinoic acid receptor, gamma
Gene Symbol
RARG
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 NAS:BHF-UCL C integral component of membrane
GO:0000790 IEA:Ensembl C nuclear chromatin
GO:0005654 TAS:Reactome C nucleoplasm
GO:0005634 IDA:UniProtKB C nucleus
GO:0005667 ISS:BHF-UCL C transcription factor complex
GO:0003677 ISS:BHF-UCL F DNA binding
GO:0000977 IEA:Ensembl F RNA polymerase II regulatory region sequence-specific DNA binding
GO:0003708 IEA:Ensembl F retinoic acid receptor activity
GO:0046965 ISS:BHF-UCL F retinoid X receptor binding
GO:0003700 ISS:BHF-UCL F sequence-specific DNA binding transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0070384 IEA:Ensembl P Harderian gland development
GO:0009952 IEA:Ensembl P anterior/posterior pattern specification
GO:0060070 TAS:BHF-UCL P canonical Wnt signaling pathway
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0031076 IEA:Ensembl P embryonic camera-type eye development
GO:0048048 ISS:BHF-UCL P embryonic eye morphogenesis
GO:0035116 ISS:BHF-UCL P embryonic hindlimb morphogenesis
GO:0060324 IEA:Ensembl P face development
GO:0010467 TAS:Reactome P gene expression
GO:0002068 IEA:Ensembl P glandular epithelial cell development
GO:0003430 IEA:Ensembl P growth plate cartilage chondrocyte growth
GO:0035264 IEA:Ensembl P multicellular organism growth
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0061037 IEA:Ensembl P negative regulation of cartilage development
GO:0008285 ISS:BHF-UCL P negative regulation of cell proliferation
GO:0032331 IEA:Ensembl P negative regulation of chondrocyte differentiation
GO:0000122 ISS:BHF-UCL P negative regulation of transcription from RNA polymerase II promoter
GO:0001843 IEA:Ensembl P neural tube closure
GO:0043065 ISS:BHF-UCL P positive regulation of apoptotic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0043068 ISS:BHF-UCL P positive regulation of programmed cell death
GO:0045944 ISS:BHF-UCL P positive regulation of transcription from RNA polymerase II promoter
GO:0060740 IEA:Ensembl P prostate gland epithelium morphogenesis
GO:0008361 TAS:BHF-UCL P regulation of cell size
GO:0031641 IEA:Ensembl P regulation of myelination
GO:0032526 IDA:BHF-UCL P response to retinoic acid
GO:0003406 IEA:Ensembl P retinal pigment epithelium development
GO:0048384 IDA:BHF-UCL P retinoic acid receptor signaling pathway
GO:0060534 IEA:Ensembl P trachea cartilage development
GO:0006367 TAS:Reactome P transcription initiation from RNA polymerase II promoter

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003078 Retinoic acid receptor
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor, gamma
Protein Entry
RARG_HUMAN
UniProt ID
P13631
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Comment=Isoforms differ only in their N-terminal regions.; Name=1; IsoId=P13631-1; Sequence=Displayed; Name=2; IsoId=P13631-2; Sequence=VSP_031080; Name=3; IsoId=P13631-3; Sequence=VSP_044777; Note=No experimental confirmation available.; Name=4; IsoId=P13631-4; Sequence=VSP_044776; Note=No experimental confirmation available.;
Domain Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
Function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function (By similarity)
Interaction O60504-2:SORBS3; NbExp=2; IntAct=EBI-2568901, EBI-1222956;
Sequence Caution Sequence=CAA40548.1; Type=Erroneous gene model prediction; Evidence= ;
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily
Similarity Contains 1 nuclear receptor DNA-binding domain
Subcellular Location Nucleus.
Subunit Homodimer. Heterodimer with a RXR molecule. Binds DNA preferentially as a RAR/RXR heterodimer. Forms a complex with PUS1 and the SRA1 RNA in the nucleus
Web Resource Name=Wikipedia; Note=Retinoic acid receptor entry; URL="http://en.wikipedia.org/wiki/Retinoic_acid_receptor";

Identical and Related Proteins

Unique RefSeq proteins for LMP001246 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4506423 RefSeq NP_000957 454 retinoic acid receptor gamma isoform 1
112181200 RefSeq NP_001036193 443 retinoic acid receptor gamma isoform 2
344030240 RefSeq NP_001230661 432 retinoic acid receptor gamma isoform 3
344030235 RefSeq NP_001230659 382 retinoic acid receptor gamma isoform 4
344030237 RefSeq NP_001230660 333 retinoic acid receptor gamma isoform 5

Identical Sequences to LMP001246 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP001246 proteins

Reference Database Accession Length Protein Name