Gene/Proteome Database (LMPD)

LMPD ID
LMP001272
Gene ID
3248
Species
Homo sapiens (Human)
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
HPGD
Synonyms
15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Alternate Names
15-hydroxyprostaglandin dehydrogenase [NAD(+)]; prostaglandin dehydrogenase 1; NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 36C, member 1
Chromosome
4
Map Location
4q34-q35
EC Number
1.1.1.141
Summary
This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
Orthologs
View orthologs and multiple alignments for HPGD

Proteins

15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1
Refseq ID NP_000851
Protein GI 31542939
UniProt ID P15428
mRNA ID NM_000860
Length 266
RefSeq Status REVIEWED
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2
Refseq ID NP_001139288
Protein GI 224922801
UniProt ID P15428
mRNA ID NM_001145816
Length 178
RefSeq Status REVIEWED
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAAPTIDCQWIDNTH
15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3
Refseq ID NP_001243230
Protein GI 372626410
UniProt ID P15428
mRNA ID NM_001256301
Length 145
RefSeq Status REVIEWED
MSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3
Refseq ID NP_001243236
Protein GI 372626423
UniProt ID P15428
mRNA ID NM_001256307
Length 145
RefSeq Status REVIEWED
Protein sequence is identical to GI:372626410 (mRNA isoform)
15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4
Refseq ID NP_001243234
Protein GI 372626421
UniProt ID P15428
mRNA ID NM_001256305
Length 143
RefSeq Status REVIEWED
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAAHH
15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5
Refseq ID NP_001243235
Protein GI 372626419
UniProt ID P15428
mRNA ID NM_001256306
Length 198
RefSeq Status REVIEWED
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Gene Information

Entrez Gene ID
3248
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
HPGD
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0005829 NAS:UniProtKB C cytosol
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016404 IDA:UniProtKB F 15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0051287 IDA:UniProtKB F NAD binding
GO:0070403 IDA:UniProtKB F NAD+ binding
GO:0003824 IDA:UniProtKB F catalytic activity
GO:0004957 IDA:UniProtKB F prostaglandin E receptor activity
GO:0042803 TAS:UniProtKB F protein homodimerization activity
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0019371 TAS:Reactome P cyclooxygenase pathway
GO:0097070 ISS:UniProtKB P ductus arteriosus closure
GO:0007565 IDA:UniProtKB P female pregnancy
GO:2001300 TAS:Reactome P lipoxin metabolic process
GO:0019372 TAS:UniProtKB P lipoxygenase pathway
GO:0045786 IDA:UniProtKB P negative regulation of cell cycle
GO:0030728 ISS:UniProtKB P ovulation
GO:0007567 IDA:UniProtKB P parturition
GO:0006693 IDA:UniProtKB P prostaglandin metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0070493 ISS:UniProtKB P thrombin receptor signaling pathway
GO:0007179 IDA:UniProtKB P transforming growth factor beta receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
hsa05202 Transcriptional misregulation in cancer

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150320 Synthesis of Lipoxins (LX)
REACT_150149 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Protein Entry
PGDH_HUMAN
UniProt ID
P15428
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P15428-1; Sequence=Displayed; Name=2; IsoId=P15428-2; Sequence=VSP_043032; Name=3; IsoId=P15428-3; Sequence=VSP_045106; Name=4; IsoId=P15428-4; Sequence=VSP_045107, VSP_045108; Name=5; IsoId=P15428-5; Sequence=VSP_045579; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=3.4 uM for prostaglandin E2 ; KM=38 uM for NAD ;
Catalytic Activity (5Z,13E,15S)-11-alpha,15-dihydroxy-9-oxoprost- 5,13-dienoate + NAD(+) = (5Z,13E)-11-alpha-hydroxy-9,15- dioxoprost-5,13-dienoate + NADH.
Disease Cranioosteoarthropathy (COA) [MIM
Disease Hypertrophic osteoarthropathy, primary, autosomal recessive, 1 (PHOAR1) [MIM
Disease Isolated congenital nail clubbing (ICNC) [MIM
Function Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells. {ECO
Induction Down-regulated by cortisol, dexamethasone and betamethasone. Down-regulated in colon cancer. Up-regulated by TGFB1.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Subcellular Location Cytoplasm.
Subunit Homodimer.
Tissue Specificity Detected in colon epithelium (at protein level).
Web Resource Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/hpgd/";

Identical and Related Proteins

Unique RefSeq proteins for LMP001272 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
31542939 RefSeq NP_000851 266 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1
224922801 RefSeq NP_001139288 178 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2
372626410 RefSeq NP_001243230 145 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3
372626421 RefSeq NP_001243234 143 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4
372626419 RefSeq NP_001243235 198 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5

Identical Sequences to LMP001272 proteins

Reference Database Accession Length Protein Name
GI:224922801 DBBJ BAG62569.1 178 unnamed protein product [Homo sapiens]
GI:372626410 DBBJ BAH12408.1 145 unnamed protein product [Homo sapiens]
GI:224922801 EMBL CAH91458.1 178 hypothetical protein [Pongo abelii]
GI:372626421 GenBank AAB53034.1 143 15-hydroxyprostaglandin dehydrogenase [Homo sapiens]
GI:372626421 GenBank EAX04735.1 143 hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_b [Homo sapiens]
GI:224922801 GenBank EAX04737.1 178 hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_c [Homo sapiens]
GI:31542939 GenBank AGD01470.1 266 Sequence 993 from patent US 8338124
GI:31542939 GenBank AHD76715.1 266 Sequence 20935 from patent US 8586006
GI:31542939 GenBank AIC48975.1 266 HPGD, partial [synthetic construct]
GI:224922801 RefSeq NP_001125858.1 178 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Pongo abelii]
GI:372626410 RefSeq NP_001243236.1 145 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 [Homo sapiens]
GI:31542939 RefSeq XP_004040694.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1 [Gorilla gorilla gorilla]
GI:224922801 RefSeq XP_004040695.1 178 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Gorilla gorilla gorilla]
GI:372626410 RefSeq XP_004040696.1 145 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 3 [Gorilla gorilla gorilla]
GI:372626419 RefSeq XP_004040697.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 4 [Gorilla gorilla gorilla]
GI:372626421 RefSeq XP_004040698.1 143 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 5 [Gorilla gorilla gorilla]
GI:372626410 RefSeq XP_004040699.1 145 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 6 [Gorilla gorilla gorilla]
GI:31542939 RefSeq XP_009238735.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X1 [Pongo abelii]
GI:372626419 RefSeq XP_009238736.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Pongo abelii]
GI:372626410 RefSeq XP_009238737.1 145 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Pongo abelii]
GI:372626410 RefSeq XP_009238738.1 145 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Pongo abelii]
GI:372626421 RefSeq XP_009238739.1 143 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X4 [Pongo abelii]
GI:31542939 RefSeq XP_010358396.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Rhinopithecus roxellana]

Related Sequences to LMP001272 proteins

Reference Database Accession Length Protein Name
GI:372626421 DBBJ BAG62569.1 178 unnamed protein product [Homo sapiens]
GI:372626419 DBBJ BAG61916.1 198 unnamed protein product [Homo sapiens]
GI:224922801 EMBL CAA57843.1 178 15-hydroxy prostaglandin dehydrogenase [Homo sapiens]
GI:31542939 EMBL CAD19065.1 266 unnamed protein product [Homo sapiens]
GI:372626410 EMBL CAD19065.1 266 unnamed protein product [Homo sapiens]
GI:372626410 GenBank AAA89174.1 266 NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens]
GI:31542939 GenBank AAA89174.1 266 NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens]
GI:31542939 GenBank AAA89175.1 266 NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens]
GI:372626410 GenBank AAA89175.1 266 NAD+-dependent 15-hydroxyprostaglandin dehydrogenase [Homo sapiens]
GI:372626421 GenBank EAX04737.1 178 hydroxyprostaglandin dehydrogenase 15-(NAD), isoform CRA_c [Homo sapiens]
GI:372626410 GenBank ADL88137.1 266 Sequence 218 from patent US 7705120
GI:31542939 GenBank ADL88137.1 266 Sequence 218 from patent US 7705120
GI:372626421 RefSeq NP_001139288.1 178 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Homo sapiens]
GI:224922801 RefSeq XP_003258037.1 178 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Nomascus leucogenys]
GI:31542939 RefSeq XP_003823475.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Pan paniscus]
GI:31542939 RefSeq XP_003899423.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Papio anubis]
GI:372626421 RefSeq XP_004040695.1 178 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Gorilla gorilla gorilla]
GI:372626421 RefSeq XP_004088610.1 143 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Nomascus leucogenys]
GI:372626419 RefSeq XP_004088611.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Nomascus leucogenys]
GI:372626419 RefSeq XP_004433558.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 2 [Ceratotherium simum simum]
GI:372626421 RefSeq XP_004579093.1 143 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Ochotona princeps]
GI:372626419 RefSeq XP_004766146.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Mustela putorius furo]
GI:372626419 RefSeq XP_004825150.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Mustela putorius furo]
GI:224922801 RefSeq XP_005209869.1 180 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Bos taurus]
GI:372626419 RefSeq XP_005556383.1 198 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Macaca fascicularis]
GI:224922801 RefSeq XP_005556384.1 178 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Macaca fascicularis]
GI:224922801 RefSeq XP_005892244.1 180 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X2 [Bos mutus]
GI:224922801 RefSeq XP_006056338.1 178 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X3 [Bubalus bubalis]
GI:372626410 RefSeq XP_009238735.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform X1 [Pongo abelii]
GI:372626410 RefSeq XP_010358396.1 266 PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Rhinopithecus roxellana]