Gene/Proteome Database (LMPD)
LMPD ID
LMP001335
Gene ID
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 4, subfamily A, polypeptide 11
Gene Symbol
Synonyms
CP4Y; CYP4A2; CYP4AII
Alternate Names
cytochrome P450 4A11; CYPIVA11; P450HL-omega; 20-HETE synthase; alkane-1 monooxygenase; cytochrome P450HL-omega; cytochrome P-450HK-omega; fatty acid omega-hydroxylase; lauric acid omega-hydroxylase; 20-hydroxyeicosatetraenoic acid synthase; cytochrome P450, subfamily IVA, polypeptide 11
Chromosome
1
Map Location
1p33
EC Number
1.14.15.3
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| cytochrome P450 4A11 | |
|---|---|
| Refseq ID | NP_000769 |
| Protein GI | 158937242 |
| UniProt ID | Q02928 |
| mRNA ID | NM_000778 |
| Length | 519 |
| RefSeq Status | REVIEWED |
| MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL | |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 4, subfamily A, polypeptide 11
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016324 | IDA:UniProtKB | C | apical plasma membrane |
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0043231 | IDA:UniProtKB | C | intracellular membrane-bounded organelle |
| GO:0018685 | IDA:BHF-UCL | F | alkane 1-monooxygenase activity |
| GO:0008392 | IDA:UniProtKB | F | arachidonic acid epoxygenase activity |
| GO:0052869 | IEA:UniProtKB-EC | F | arachidonic acid omega-hydroxylase activity |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0050051 | IDA:UniProtKB | F | leukotriene-B4 20-monooxygenase activity |
| GO:0019369 | IDA:UniProtKB | P | arachidonic acid metabolic process |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0019373 | IDA:UniProtKB | P | epoxygenase P450 pathway |
| GO:0006631 | TAS:ProtInc | P | fatty acid metabolic process |
| GO:0036101 | IDA:GOC | P | leukotriene B4 catabolic process |
| GO:0006691 | IDA:UniProtKB | P | leukotriene metabolic process |
| GO:0001676 | IDA:BHF-UCL | P | long-chain fatty acid metabolic process |
| GO:0097267 | TAS:Reactome | P | omega-hydroxylase P450 pathway |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
| GO:0032305 | IMP:UniProtKB | P | positive regulation of icosanoid secretion |
| GO:0003095 | IEP:UniProtKB | P | pressure natriuresis |
| GO:0003091 | IEP:UniProtKB | P | renal water homeostasis |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0055078 | IEP:UniProtKB | P | sodium ion homeostasis |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04270 | Vascular smooth muscle contraction |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150134 | Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) |
| REACT_150420 | Synthesis of Leukotrienes (LT) and Eoxins (EX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 4, subfamily A, polypeptide 11
Protein Entry
CP4AB_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q02928-1; Sequence=Displayed; Name=2; IsoId=Q02928-2; Sequence=VSP_034595; |
| Catalytic Activity | Octane + 2 reduced rubredoxin + O(2) + 2 H(+) = 1-octanol + 2 oxidized rubredoxin + H(2)O. |
| Cofactor | Name=heme; Xref=ChEBI |
| Function | Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate, myristate and palmitate. Has little activity toward prostaglandins A1 and E1. Oxidizes arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE). {ECO |
| Polymorphism | CYP4A11v seems to be a rare allelic variant of CYP4A11, it seems to be unstable and not to metabolize lauric acid. |
| Similarity | Belongs to the cytochrome P450 family. |
| Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. |
| Tissue Specificity | Kidney and liver. |
| Web Resource | Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP4A11 alleles; URL="http://www.cypalleles.ki.se/cyp4a11.htm"; |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/cyp4a11/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001335 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 158937242 | RefSeq | NP_000769 | 519 | cytochrome P450 4A11 |
Identical Sequences to LMP001335 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158937242 | DBBJ | BAA05491.1 | 519 | fatty acids omega-hydroxylase [Homo sapiens] |
| GI:158937242 | GenBank | AAA58436.1 | 519 | cytochrome P450 [Homo sapiens] |
| GI:158937242 | GenBank | AAQ56847.1 | 519 | cytochrome P450, family 4, subfamily A, polypeptide 11 [Homo sapiens] |
| GI:158937242 | PRF | - | 519 | fatty acid omega-hydroxylase (cytochrome P450 4A) [Homo sapiens] |
| GI:158937242 | SwissProt | Q02928.1 | 519 | RecName: Full=Cytochrome P450 4A11; AltName: Full=20-hydroxyeicosatetraenoic acid synthase; Short=20-HETE synthase; AltName: Full=CYP4AII; AltName: Full=CYPIVA11; AltName: Full=Cytochrome P-450HK-omega; AltName: Full=Cytochrome P450HL-omega; AltName: Full=Fatty acid omega-hydroxylase; AltName: Full=Lauric acid omega-hydroxylase; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP001335 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:158937242 | DBBJ | BAA02864.1 | 521 | fatty acid omega-hydroxylase [Homo sapiens] |
| GI:158937242 | GenBank | AAB29502.1 | 519 | fatty acid omega-hydroxylase [Homo sapiens] |
| GI:158937242 | GenBank | AAO16078.1 | 519 | cytochrome P450, subfamily IVA, polypeptide 11 [Homo sapiens] |
| GI:158937242 | GenBank | EAX06886.1 | 519 | hCG1780371, isoform CRA_b [Homo sapiens] |
| GI:158937242 | GenBank | AHD74899.1 | 519 | Sequence 15603 from patent US 8586006 |
| GI:158937242 | RefSeq | XP_008963435.1 | 519 | PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 4A11 [Pan paniscus] |