Gene/Proteome Database (LMPD)

LMPD ID
LMP001384
Gene ID
17969
Species
Mus musculus (Mouse)
Gene Name
neutrophil cytosolic factor 1
Gene Symbol
Ncf1
Synonyms
NCF-47K; NOXO2; Ncf-1; p47-phox; p47<phox>; p47phox
Chromosome
5
Map Location
5 G2|5 74.47 cM

Proteins

neutrophil cytosol factor 1 isoform a
Refseq ID NP_001272966
Protein GI 553727131
UniProt ID Q3UBI5
mRNA ID NM_001286037
Length 404
MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKGERQGGPGPGLEGRDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV
neutrophil cytosol factor 1 isoform b
Refseq ID NP_035006
Protein GI 170172553
UniProt ID Q3UBI5
mRNA ID NM_010876
Length 390
MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV

Gene Information

Entrez Gene ID
17969
Gene Name
neutrophil cytosolic factor 1
Gene Symbol
Ncf1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043020 ISS:UniProtKB C NADPH oxidase complex
GO:0005737 IDA:MGI C cytoplasm
GO:0005829 ISA:MGI C cytosol
GO:0019898 ISS:UniProtKB C extrinsic component of membrane
GO:0035091 IEA:InterPro F phosphatidylinositol binding
GO:0035091 ISS:UniProtKB F phosphatidylinositol binding
GO:0043325 ISS:UniProtKB F phosphatidylinositol-3,4-bisphosphate binding
GO:0016175 IDA:MGI F superoxide-generating NADPH oxidase activity
GO:0006742 ISA:MGI P NADP catabolic process
GO:0008283 IMP:MGI P cell proliferation
GO:0006968 IMP:MGI P cellular defense response
GO:0050830 IMP:MGI P defense response to Gram-positive bacterium
GO:0042742 IMP:MGI P defense response to bacterium
GO:0050832 IMP:MGI P defense response to fungus
GO:0050665 IMP:MGI P hydrogen peroxide biosynthetic process
GO:0006954 IMP:MGI P inflammatory response
GO:0001909 IMP:MGI P leukocyte mediated cytotoxicity
GO:0006691 IMP:MGI P leukotriene metabolic process
GO:0045986 IMP:MGI P negative regulation of smooth muscle contraction
GO:0070947 IMP:MGI P neutrophil mediated killing of fungus
GO:0070946 IMP:MGI P neutrophil mediated killing of gram-positive bacterium
GO:0055114 IDA:GOC P oxidation-reduction process
GO:0006612 ISS:UniProtKB P protein targeting to membrane
GO:0045730 IMP:MGI P respiratory burst
GO:0002679 IMP:MGI P respiratory burst involved in defense response
GO:0009617 IMP:MGI P response to bacterium
GO:0001878 IMP:MGI P response to yeast
GO:0042554 IMP:MGI P superoxide anion generation

KEGG Pathway Links

KEGG Pathway ID Description
ko04062 Chemokine signaling pathway
mmu04062 Chemokine signaling pathway
ko04666 Fc gamma R-mediated phagocytosis
mmu04666 Fc gamma R-mediated phagocytosis
ko05140 Leishmaniasis
mmu05140 Leishmaniasis
ko04670 Leukocyte transendothelial migration
mmu04670 Leukocyte transendothelial migration
ko04380 Osteoclast differentiation
mmu04380 Osteoclast differentiation
ko04145 Phagosome
mmu04145 Phagosome

REACTOME Pathway Links

REACTOME Pathway ID Description
5892925 Adaptive Immune System
5893931 Antigen processing-Cross presentation
5893914 Class I MHC mediated antigen processing & presentation
5893934 Cross-presentation of particulate exogenous antigens (phagosomes)
5892763 Disease
5892920 Immune System
5893747 Latent infection of Homo sapiens with Mycobacterium tuberculosis
5893746 Phagosomal maturation (early endosomal stage)
5892891 Signal Transduction
5892930 Signaling by VEGF
5892929 VEGFA-VEGFR2 Pathway

Domain Information

InterPro Annotations

Accession Description
IPR015039 NADPH oxidase subunit p47Phox, C-terminal
IPR001655 Neutrophil cytosol factor 1
IPR001683 Phox homologous domain
IPR001452 SH3_domain

UniProt Annotations

Entry Information

Gene Name
neutrophil cytosolic factor 1
Protein Entry
Q3UBI5_MOUSE
UniProt ID
Q3UBI5
Species
Mouse

Comments

Comment Type Description
Domain The PX domain mediates interaction with phosphatidylinositol 3,4-bisphosphate and other anionic phospholipids. In the autoinhibited, unphosphorylated state an intramolecular interaction with the C-terminal SH3 domain precludes phospholipid binding and interaction with CYBA. Phosphorylation disrupts the autoinhibited state (By similarity). {ECO:0000250}.
Function NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production). {ECO:0000269|PubMed:9490028}.
Ptm Phosphorylated by PRKCD; phosphorylation induces activation of NCF1 and NADPH oxidase activity. {ECO:0000250}.
Similarity Contains 1 PX (phox homology) domain. {ECO:0000255|PROSITE-ProRule:PRU00147}.
Similarity Contains 2 SH3 domains
Similarity Contains 2 SH3 domains. {ECO:0000255|PROSITE- ProRule:PRU00192}.
Subcellular Location Cytoplasm, cytosol {ECO:0000250}. Membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}.
Subunit Component of an NADPH oxidase complex composed of a heterodimer formed by the membrane proteins CYBA and CYBB and the cytosolic subunits NCF1, NCF2 and NCF4. Interacts (via C-terminus) with NCF2 (via the C-terminal SH3 domain). Interacts with NCF4. Interacts with CYBB. Interacts (via the second SH3 domain) with CYBA. Interacts with NOXA1. Interacts with ADAM15. Interacts with TRAF4. Interacts with FASLG (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001384 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
553727131 RefSeq NP_001272966 404 neutrophil cytosol factor 1 isoform a
170172553 RefSeq NP_035006 390 neutrophil cytosol factor 1 isoform b

Identical Sequences to LMP001384 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP001384 proteins

Reference Database Accession Length Protein Name