Gene/Proteome Database (LMPD)

LMPD ID
LMP001393
Gene ID
11758
Species
Mus musculus (Mouse)
Gene Name
peroxiredoxin 6
Gene Symbol
Prdx6
Synonyms
1-cysPrx; 9430088D19Rik; AA690119; Aop2; Aop2-rs3; Brp-12; CC26; CP-3; GPx; Ltw-4; Ltw4; Lvtw-4; NSGP; NSGPx; ORF06; Prdx5; Prdx6-rs3; aiPLA2; mKIAA0106
Alternate Names
peroxiredoxin-6; 1-Cys Prx; 1-Cys peroxiredoxin; antioxidant protein 2; non-selenium glutathione peroxidase; peroxiredoxin 5, related sequence 3; peroxiredoxin 6, related sequence 3; anti-oxidant protein 2, related sequence 3; acidic calcium-independent phospholipase A2
Chromosome
1
Map Location
1 H2.1|1 69.75 cM
EC Number
1.11.1.15

Proteins

peroxiredoxin-6
Refseq ID NP_031479
Protein GI 6671549
UniProt ID O08709
mRNA ID NM_007453
Length 224
RefSeq Status PROVISIONAL
MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDANNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP

Gene Information

Entrez Gene ID
11758
Gene Name
peroxiredoxin 6
Gene Symbol
Prdx6
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005829 IDA:MGI C cytosol
GO:0005764 IEA:UniProtKB-KW C lysosome
GO:0005739 IDA:MGI C mitochondrion
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0016787 IEA:UniProtKB-KW F hydrolase activity
GO:0004601 IMP:MGI F peroxidase activity
GO:0051920 IEA:UniProtKB-EC F peroxiredoxin activity
GO:0032060 IMP:MGI P bleb assembly
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0000302 IMP:MGI P response to reactive oxygen species

KEGG Pathway Links

KEGG Pathway ID Description
mmu01100 Metabolic pathways
mmu00360 Phenylalanine metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6355 phosphate acquisition II

REACTOME Pathway Links

REACTOME Pathway ID Description
5892833 Detoxification of Reactive Oxygen Species

Domain Information

InterPro Annotations

Accession Description
IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
IPR024706 Peroxiredoxin, AhpC-type
IPR019479 Peroxiredoxin, C-terminal
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
peroxiredoxin 6
Protein Entry
PRDX6_MOUSE
UniProt ID
O08709
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 2 R'-SH + ROOH = R'-S-S-R' + H(2)O + ROH.
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity). {ECO:0000250}.
Interaction P19157:Gstp1; NbExp=2; IntAct=EBI-444895, EBI-2309446; O70145:Ncf2; NbExp=3; IntAct=EBI-444895, EBI-9550667;
Miscellaneous Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. {ECO:0000250}.
Miscellaneous The active site is the redox-active Cys-47 oxidized to Cys-SOH. Unlike 2-Cys peroxiredoxins, PRDX6 conserves only this peroxidatic cysteine. To regenerate and activate the enzyme, the oxidized form is directly reduced to cysteine by glutathione and not thioredoxin (By similarity). {ECO:0000250}.
Similarity Belongs to the AhpC/TSA family. Rehydrin subfamily. {ECO:0000305}.
Similarity Contains 1 thioredoxin domain. {ECO:0000255|PROSITE- ProRule:PRU00691}.
Subcellular Location Cytoplasm {ECO:0000250}. Lysosome {ECO:0000250}. Cytoplasmic vesicle {ECO:0000250}. Note=Also found in lung secretory organelles. {ECO:0000250}.
Subunit Homodimer. Interacts with GSTP1; mediates PRDX6 glutathionylation and regeneration. Interacts with APEX1 and STH (By similarity). May interact with FAM168B (By similarity). May interact with HTR2A. {ECO:0000250, ECO:0000269|PubMed:14988405}.
Tissue Specificity Highly expressed in heart, kidney and liver. Moderate expression in brain and stomach. Very low levels in intestine.

Identical and Related Proteins

Unique RefSeq proteins for LMP001393 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6671549 RefSeq NP_031479 224 peroxiredoxin-6

Identical Sequences to LMP001393 proteins

Reference Database Accession Length Protein Name
GI:6671549 DBBJ BAC26952.1 224 unnamed protein product [Mus musculus]
GI:6671549 DBBJ BAE36544.1 224 unnamed protein product [Mus musculus]
GI:6671549 DBBJ BAE34210.1 224 unnamed protein product [Mus musculus]
GI:6671549 GenBank AAC63376.1 224 1-Cys peroxiredoxin [Mus musculus]
GI:6671549 GenBank AAH13489.1 224 Peroxiredoxin 6 [Mus musculus]
GI:6671549 GenBank AAH61181.1 224 Peroxiredoxin 6 [Mus musculus]

Related Sequences to LMP001393 proteins

Reference Database Accession Length Protein Name
GI:6671549 DBBJ BAD32166.1 227 mKIAA0106 protein, partial [Mus musculus]
GI:6671549 DBBJ BAE40177.1 224 unnamed protein product [Mus musculus]
GI:6671549 EMBL CAA73383.1 224 nonselenium glutathione peroxidase [Mus musculus]
GI:6671549 GenBank AAP21829.1 224 peroxiredoxin 6 [Mus musculus]
GI:6671549 GenBank AEU43360.1 224 Sequence 109 from patent US 8052970
GI:6671549 SwissProt O08709.3 224 RecName: Full=Peroxiredoxin-6; AltName: Full=1-Cys peroxiredoxin; Short=1-Cys PRX; AltName: Full=Acidic calcium-independent phospholipase A2; Short=aiPLA2; AltName: Full=Antioxidant protein 2; AltName: Full=Non-selenium glutathione peroxidase; Short=NSGPx [Mus musculus]