Gene/Proteome Database (LMPD)

LMPD ID
LMP001395
Gene ID
78920
Species
Mus musculus (Mouse)
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Dlst
Synonyms
1600017E01Rik; 4632413C10Rik; 4930529O08Rik; DLTS
Alternate Names
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; 2-oxoglutarate dehydrogenase complex component E2; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Chromosome
12
Map Location
12|12 D3
EC Number
2.3.1.61

Proteins

dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Refseq ID NP_084501
Protein GI 21313536
UniProt ID Q9D2G2
mRNA ID NM_030225
Length 454
RefSeq Status VALIDATED
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCRGPGYPDNRKMVINSGSVFRVRFFQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAETPAPAHKAEPAAPAAPPPPAAPVLTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
transit_peptide: 1..68 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9D2G2.1) calculated_mol_wt: 7543 peptide sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCRGPGYPDNRKMVINSGSVFRVRFFQTTAVCK mat_peptide: 69..454 product: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D2G2.1) calculated_mol_wt: 41470 peptide sequence: NDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAETPAPAHKAEPAAPAAPPPPAAPVLTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Gene Information

Entrez Gene ID
78920
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Dlst
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005739 IDA:MGI C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0045252 IEA:InterPro C oxoglutarate dehydrogenase complex
GO:0004149 IEA:UniProtKB-EC F dihydrolipoyllysine-residue succinyltransferase activity
GO:0033512 IEA:UniProtKB-UniPathway P L-lysine catabolic process to acetyl-CoA via saccharopine
GO:0006099 IEA:UniProtKB-KW P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
mmu01200 Carbon metabolism
mmu00020 Citrate cycle (TCA cycle)

Domain Information

InterPro Annotations

Accession Description
IPR003016 2-oxo acid dehydrogenase, lipoyl-binding site
IPR001078 2-oxoacid dehydrogenase acyltransferase, catalytic domain
IPR000089 Biotin/lipoyl attachment
IPR023213 Chloramphenicol acetyltransferase-like domain
IPR006255 Dihydrolipoamide succinyltransferase
IPR011053 Single hybrid motif

UniProt Annotations

Entry Information

Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Protein Entry
ODO2_MOUSE
UniProt ID
Q9D2G2
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9D2G2-1; Sequence=Displayed; Name=2; IsoId=Q9D2G2-2; Sequence=VSP_025015, VSP_025016; Note=No experimental confirmation available.;
Catalytic Activity Succinyl-CoA + enzyme N(6)- (dihydrolipoyl)lysine = CoA + enzyme N(6)-(S- succinyldihydrolipoyl)lysine.
Cofactor Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088; Evidence={ECO:0000250}; Note=Binds 1 lipoyl cofactor covalently. {ECO:0000250};
Function The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). {ECO:0000250}.
Pathway Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6.
Similarity Belongs to the 2-oxoacid dehydrogenase family. {ECO:0000305}.
Similarity Contains 1 lipoyl-binding domain. {ECO:0000255|PROSITE-ProRule:PRU01066, ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000250}.
Subunit Forms a 24-polypeptide structural core with octahedral symmetry. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001395 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21313536 RefSeq NP_084501 454 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

Identical Sequences to LMP001395 proteins

Reference Database Accession Length Protein Name
GI:21313536 DBBJ BAE34709.1 454 unnamed protein product [Mus musculus]
GI:21313536 DBBJ BAE41472.1 454 unnamed protein product [Mus musculus]
GI:21313536 DBBJ BAE40440.1 454 unnamed protein product [Mus musculus]
GI:21313536 EMBL CAJ18405.1 454 Dlst [Mus musculus]
GI:21313536 GenBank EDL02845.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_d [Mus musculus]
GI:21313536 GenBank EDL02846.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_d [Mus musculus]

Related Sequences to LMP001395 proteins

Reference Database Accession Length Protein Name
GI:21313536 DBBJ BAE29011.1 454 unnamed protein product [Mus musculus]
GI:21313536 GenBank EDL81544.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:21313536 GenBank EDL81545.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:21313536 GenBank EDL81546.1 454 dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus]
GI:21313536 RefSeq NP_001006982.2 454 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Rattus norvegicus]
GI:21313536 RefSeq XP_006516455.1 453 PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial isoform X1 [Mus musculus]