Gene/Proteome Database (LMPD)
LMPD ID
LMP001395
Gene ID
Species
Mus musculus (Mouse)
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Synonyms
1600017E01Rik; 4632413C10Rik; 4930529O08Rik; DLTS
Alternate Names
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; 2-oxoglutarate dehydrogenase complex component E2; dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Chromosome
12
Map Location
12|12 D3
EC Number
2.3.1.61
Proteins
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial | |
---|---|
Refseq ID | NP_084501 |
Protein GI | 21313536 |
UniProt ID | Q9D2G2 |
mRNA ID | NM_030225 |
Length | 454 |
RefSeq Status | VALIDATED |
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCRGPGYPDNRKMVINSGSVFRVRFFQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAETPAPAHKAEPAAPAAPPPPAAPVLTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL | |
transit_peptide: 1..68 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9D2G2.1) calculated_mol_wt: 7543 peptide sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCRGPGYPDNRKMVINSGSVFRVRFFQTTAVCK mat_peptide: 69..454 product: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D2G2.1) calculated_mol_wt: 41470 peptide sequence: NDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPANGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAETPAPAHKAEPAAPAAPPPPAAPVLTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0005634 | IEA:Ensembl | C | nucleus |
GO:0045252 | IEA:InterPro | C | oxoglutarate dehydrogenase complex |
GO:0004149 | IEA:UniProtKB-EC | F | dihydrolipoyllysine-residue succinyltransferase activity |
GO:0033512 | IEA:UniProtKB-UniPathway | P | L-lysine catabolic process to acetyl-CoA via saccharopine |
GO:0006099 | IEA:UniProtKB-KW | P | tricarboxylic acid cycle |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
IPR000089 | Biotin/lipoyl attachment |
IPR023213 | Chloramphenicol acetyltransferase-like domain |
IPR006255 | Dihydrolipoamide succinyltransferase |
IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Protein Entry
ODO2_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9D2G2-1; Sequence=Displayed; Name=2; IsoId=Q9D2G2-2; Sequence=VSP_025015, VSP_025016; Note=No experimental confirmation available.; |
Catalytic Activity | Succinyl-CoA + enzyme N(6)- (dihydrolipoyl)lysine = CoA + enzyme N(6)-(S- succinyldihydrolipoyl)lysine. |
Cofactor | Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088; Evidence={ECO:0000250}; Note=Binds 1 lipoyl cofactor covalently. {ECO:0000250}; |
Function | The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). {ECO:0000250}. |
Pathway | Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6. |
Similarity | Belongs to the 2-oxoacid dehydrogenase family. {ECO:0000305}. |
Similarity | Contains 1 lipoyl-binding domain. {ECO:0000255|PROSITE-ProRule:PRU01066, ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000250}. |
Subunit | Forms a 24-polypeptide structural core with octahedral symmetry. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001395 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21313536 | RefSeq | NP_084501 | 454 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial |
Identical Sequences to LMP001395 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21313536 | DBBJ | BAE34709.1 | 454 | unnamed protein product [Mus musculus] |
GI:21313536 | DBBJ | BAE41472.1 | 454 | unnamed protein product [Mus musculus] |
GI:21313536 | DBBJ | BAE40440.1 | 454 | unnamed protein product [Mus musculus] |
GI:21313536 | EMBL | CAJ18405.1 | 454 | Dlst [Mus musculus] |
GI:21313536 | GenBank | EDL02845.1 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_d [Mus musculus] |
GI:21313536 | GenBank | EDL02846.1 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_d [Mus musculus] |
Related Sequences to LMP001395 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21313536 | DBBJ | BAE29011.1 | 454 | unnamed protein product [Mus musculus] |
GI:21313536 | GenBank | EDL81544.1 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus] |
GI:21313536 | GenBank | EDL81545.1 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus] |
GI:21313536 | GenBank | EDL81546.1 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex), isoform CRA_a [Rattus norvegicus] |
GI:21313536 | RefSeq | NP_001006982.2 | 454 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Rattus norvegicus] |
GI:21313536 | RefSeq | XP_006516455.1 | 453 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial isoform X1 [Mus musculus] |