Gene/Proteome Database (LMPD)

LMPD ID
LMP001444
Gene ID
11814
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein C-III
Gene Symbol
Apoc3
Synonyms
apo-CIII; apoC-III
Chromosome
9
Map Location
9 A5.2|9 25.36 cM
Summary
This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Orthologs
View orthologs and multiple alignments for Apoc3

Proteins

apolipoprotein C-III isoform a
Refseq ID NP_001276684
Protein GI 577019552
UniProt ID E9QP56
mRNA ID NM_001289755
Length 137
RefSeq Status REVIEWED
MPLGRRGRKGRNKELEGEALTTQPSSPQKAWDSWYVGAMQPRTLLTVALLALLASARAEEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
apolipoprotein C-III isoform b precursor
Refseq ID NP_075603
Protein GI 15421856
UniProt ID P33622
mRNA ID NM_023114
Length 99
RefSeq Status REVIEWED
MQPRTLLTVALLALLASARAEEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2110 peptide sequence: MQPRTLLTVALLALLASARA mat_peptide: 21..99 product: Apolipoprotein C-III experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P33622.2) calculated_mol_wt: 8831 peptide sequence: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2110 peptide sequence: MQPRTLLTVALLALLASARA mat_peptide: 21..99 product: Apolipoprotein C-III experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P33622.2) calculated_mol_wt: 8831 peptide sequence: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
apolipoprotein C-III isoform b precursor
Refseq ID NP_001276685
Protein GI 577019554
UniProt ID P33622
mRNA ID NM_001289756
Length 99
RefSeq Status REVIEWED
Protein sequence is identical to GI:15421856 (mRNA isoform)

Gene Information

Entrez Gene ID
11814
Gene Name
apolipoprotein C-III
Gene Symbol
Apoc3
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:InterPro C extracellular region
GO:0008289 IEA:InterPro F lipid binding
GO:0008203 IMP:MGI P cholesterol metabolic process
GO:0006869 IEA:InterPro P lipid transport
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0019433 IMP:MGI P triglyceride catabolic process
GO:0006641 IMP:MGI P triglyceride metabolic process
GO:0006642 IMP:MGI P triglyceride mobilization

Domain Information

InterPro Annotations

Accession Description
IPR008403 Apolipoprotein CIII

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-III
Protein Entry
APOC3_MOUSE
UniProt ID
P33622
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP001444 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
577019552 RefSeq NP_001276684 137 apolipoprotein C-III isoform a
15421856 RefSeq NP_075603 99 apolipoprotein C-III isoform b precursor

Identical Sequences to LMP001444 proteins

Reference Database Accession Length Protein Name
GI:15421856 DBBJ BAB22448.1 99 unnamed protein product [Mus musculus]
GI:15421856 DBBJ BAB25563.1 99 unnamed protein product [Mus musculus]
GI:15421856 RefSeq NP_001276685.1 99 apolipoprotein C-III isoform b precursor [Mus musculus]

Related Sequences to LMP001444 proteins

Reference Database Accession Length Protein Name
GI:577019552 DBBJ BAB22448.1 99 unnamed protein product [Mus musculus]
GI:577019552 DBBJ BAB25563.1 99 unnamed protein product [Mus musculus]
GI:15421856 GenBank AAH21776.1 99 Apolipoprotein C-III [Mus musculus]
GI:577019552 GenBank AAH21776.1 99 Apolipoprotein C-III [Mus musculus]
GI:15421856 GenBank EDL25681.1 99 apolipoprotein C-III, isoform CRA_a [Mus musculus]
GI:15421856 GenBank EDL25682.1 99 apolipoprotein C-III, isoform CRA_a [Mus musculus]
GI:577019552 RefSeq NP_075603.1 99 apolipoprotein C-III isoform b precursor [Mus musculus]
GI:577019552 RefSeq XP_006510016.1 127 PREDICTED: apolipoprotein C-III isoform X1 [Mus musculus]
GI:15421856 RefSeq XP_006510016.1 127 PREDICTED: apolipoprotein C-III isoform X1 [Mus musculus]
GI:15421856 RefSeq NP_001276684.1 137 apolipoprotein C-III isoform a [Mus musculus]
GI:577019552 RefSeq NP_001276685.1 99 apolipoprotein C-III isoform b precursor [Mus musculus]
GI:15421856 SwissProt P33622.2 99 RecName: Full=Apolipoprotein C-III; Short=Apo-CIII; Short=ApoC-III; AltName: Full=Apolipoprotein C3; Flags: Precursor [Mus musculus]