Gene/Proteome Database (LMPD)
LMPD ID
LMP001448
Gene ID
Species
Homo sapiens (Human)
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Synonyms
B12QTL1; SE; SEC2; Se2; sej
Chromosome
19
Map Location
19q13.3
Summary
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
galactoside 2-alpha-L-fucosyltransferase 2 | |
---|---|
Refseq ID | NP_001091107 |
Protein GI | 148224427 |
UniProt ID | Q10981 |
mRNA ID | NM_001097638 |
Length | 343 |
RefSeq Status | REVIEWED |
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016020 | IEA:InterPro | C | membrane |
GO:0008107 | IEA:Ensembl | F | galactoside 2-alpha-L-fucosyltransferase activity |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002516 | Glycosyl transferase, family 11 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 2 (secretor status included)
Protein Entry
FUT2_HUMAN
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP001448 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
148224427 | RefSeq | NP_001091107 | 343 | galactoside 2-alpha-L-fucosyltransferase 2 |
Identical Sequences to LMP001448 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148224427 | EMBL | CAQ81982.1 | 343 | fucosyltransferase [Homo sapiens] |
GI:148224427 | EMBL | CAQ81983.1 | 343 | fucosyltransferase [Homo sapiens] |
GI:148224427 | EMBL | CAQ81984.1 | 343 | fucosyltransferase [Homo sapiens] |
GI:148224427 | GenBank | AED03430.1 | 343 | Sequence 2 from patent US 7871785 |
GI:148224427 | GenBank | AFG79840.1 | 343 | Sequence 99 from patent US 8137928 |
GI:148224427 | GenBank | AHE19906.1 | 343 | Sequence 2 from patent US 8574850 |
Related Sequences to LMP001448 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148224427 | DBBJ | BAA21684.1 | 343 | alpha(1,2)fucosyltransferase [Homo sapiens] |
GI:148224427 | EMBL | CAQ68511.1 | 343 | fucosyltransferase [Homo sapiens] |
GI:148224427 | EMBL | CAQ81985.1 | 343 | fucosyltransferase [Homo sapiens] |
GI:148224427 | GenBank | AAU47383.1 | 343 | alpha 1,2 fucosyltransferase [Homo sapiens] |
GI:148224427 | GenBank | ABC59308.1 | 343 | alpha (1,2) fucosyltransferase [Homo sapiens] |
GI:148224427 | GenBank | AHD79839.1 | 343 | Sequence 30786 from patent US 8586006 |