Gene/Proteome Database (LMPD)

LMPD ID
LMP001448
Gene ID
Species
Homo sapiens (Human)
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Synonyms
B12QTL1; SE; SEC2; Se2; sej
Chromosome
19
Map Location
19q13.3
Summary
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

galactoside 2-alpha-L-fucosyltransferase 2
Refseq ID NP_001091107
Protein GI 148224427
UniProt ID Q10981
mRNA ID NM_001097638
Length 343
RefSeq Status REVIEWED
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
galactoside 2-alpha-L-fucosyltransferase 2
Refseq ID NP_000502
Protein GI 148237372
UniProt ID Q10981
mRNA ID NM_000511
Length 343
RefSeq Status REVIEWED
Protein sequence is identical to GI:148224427 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
fucosyltransferase 2 (secretor status included)
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IEA:InterPro C membrane
GO:0008107 IEA:Ensembl F galactoside 2-alpha-L-fucosyltransferase activity

KEGG Pathway Links

KEGG Pathway ID Description
hsa00603 Glycosphingolipid biosynthesis - globo series
ko00603 Glycosphingolipid biosynthesis - globo series
hsa00601 Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002516 Glycosyl transferase, family 11

UniProt Annotations

Entry Information

Gene Name
fucosyltransferase 2 (secretor status included)
Protein Entry
FUT2_HUMAN
UniProt ID
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP001448 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
148224427 RefSeq NP_001091107 343 galactoside 2-alpha-L-fucosyltransferase 2

Identical Sequences to LMP001448 proteins

Reference Database Accession Length Protein Name
GI:148224427 EMBL CAQ81982.1 343 fucosyltransferase [Homo sapiens]
GI:148224427 EMBL CAQ81983.1 343 fucosyltransferase [Homo sapiens]
GI:148224427 EMBL CAQ81984.1 343 fucosyltransferase [Homo sapiens]
GI:148224427 GenBank AED03430.1 343 Sequence 2 from patent US 7871785
GI:148224427 GenBank AFG79840.1 343 Sequence 99 from patent US 8137928
GI:148224427 GenBank AHE19906.1 343 Sequence 2 from patent US 8574850

Related Sequences to LMP001448 proteins

Reference Database Accession Length Protein Name
GI:148224427 DBBJ BAA21684.1 343 alpha(1,2)fucosyltransferase [Homo sapiens]
GI:148224427 EMBL CAQ68511.1 343 fucosyltransferase [Homo sapiens]
GI:148224427 EMBL CAQ81985.1 343 fucosyltransferase [Homo sapiens]
GI:148224427 GenBank AAU47383.1 343 alpha 1,2 fucosyltransferase [Homo sapiens]
GI:148224427 GenBank ABC59308.1 343 alpha (1,2) fucosyltransferase [Homo sapiens]
GI:148224427 GenBank AHD79839.1 343 Sequence 30786 from patent US 8586006