Gene/Proteome Database (LMPD)

LMPD ID
LMP001457
Gene ID
67916
Species
Mus musculus (Mouse)
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
Ppap2b
Synonyms
1110003O22Rik; 2610002D05Rik; AV025606; D4Bwg0538e; D4Bwg1535e; Lpp3; Ppab2b
Alternate Names
lipid phosphate phosphohydrolase 3; PAP2b; PAP-2b; PAP2-beta; phosphatidic acid phosphatase 2b; phosphatidate phosphohydrolase type 2b
Chromosome
4
Map Location
4 C6|4 49.18 cM
EC Number
3.1.3.4

Proteins

lipid phosphate phosphohydrolase 3
Refseq ID NP_542122
Protein GI 18017590
UniProt ID Q99JY8
mRNA ID NM_080555
Length 312
RefSeq Status VALIDATED
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVDIIDRNNHHNMV

Gene Information

Entrez Gene ID
67916
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
Ppap2b
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:MGI C plasma membrane
GO:0005178 IDA:MGI F integrin binding
GO:0042577 IMP:MGI F lipid phosphatase activity
GO:0008195 IEA:UniProtKB-EC F phosphatidate phosphatase activity
GO:0042392 IMP:MGI F sphingosine-1-phosphate phosphatase activity
GO:0060020 IMP:MGI P Bergmann glial cell differentiation
GO:0001568 IMP:MGI P blood vessel development
GO:0060070 IDA:BHF-UCL P canonical Wnt signaling pathway
GO:0044329 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion
GO:0044328 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration
GO:0044330 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of wound healing
GO:0007155 IDA:MGI P cell adhesion
GO:0016311 IMP:GOC P dephosphorylation
GO:0001702 IMP:MGI P gastrulation with mouth forming second
GO:0034109 IEA:Ensembl P homotypic cell-cell adhesion
GO:0001933 IDA:BHF-UCL P negative regulation of protein phosphorylation
GO:0006644 IMP:MGI P phospholipid metabolic process
GO:0050731 IDA:MGI P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051091 IDA:BHF-UCL P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0050821 IDA:BHF-UCL P protein stabilization
GO:0030111 IDA:MGI P regulation of Wnt signaling pathway
GO:1902068 IMP:MGI P regulation of sphingolipid mediated signaling pathway
GO:0016337 IDA:MGI P single organismal cell-cell adhesion

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu04666 Fc gamma R-mediated phagocytosis
mmu00600 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR028675 Lipid phosphate phosphohydrolase 3
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase type 2B
Protein Entry
LPP3_MOUSE
UniProt ID
Q99JY8
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate.
Disease Note=Ppap2b deficient embryos fail to form a chorioallantoic placenta and yolk sac vasculature. A subset of embryos also show a shortening of the anterior-posterior axis and frequent duplication of axial structures. Loss of Ppap2b results in a marked increase in beta-catenin-mediated T-cell factor (TCF) transcription. {ECO:0000269|PubMed:12925589}.
Function Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P) (By similarity). Essential to the formation of the chorioallantoic placenta and extraembryonic vasculature. Also mediates gastrulation and axis formation, probably by regulating the Wnt signaling pathway. {ECO:0000250, ECO:0000269|PubMed:12925589}.
Similarity Belongs to the PA-phosphatase related phosphoesterase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Homodimer. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001457 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18017590 RefSeq NP_542122 312 lipid phosphate phosphohydrolase 3

Identical Sequences to LMP001457 proteins

Reference Database Accession Length Protein Name
GI:18017590 DBBJ BAE35594.1 312 unnamed protein product [Mus musculus]
GI:18017590 GenBank AAH05558.1 312 Phosphatidic acid phosphatase type 2B [Mus musculus]
GI:18017590 GenBank EDL30823.1 312 phosphatidic acid phosphatase type 2B, isoform CRA_b [Mus musculus]
GI:18017590 SwissProt Q99JY8.1 312 RecName: Full=Lipid phosphate phosphohydrolase 3; AltName: Full=PAP2-beta; AltName: Full=Phosphatidate phosphohydrolase type 2b; AltName: Full=Phosphatidic acid phosphatase 2b; Short=PAP-2b; Short=PAP2b [Mus musculus]

Related Sequences to LMP001457 proteins

Reference Database Accession Length Protein Name
GI:18017590 DBBJ BAE34848.1 312 unnamed protein product [Mus musculus]
GI:18017590 GenBank AAH72544.1 312 Phosphatidic acid phosphatase type 2B [Rattus norvegicus]
GI:18017590 GenBank EDL97885.1 312 phosphatidic acid phosphatase type 2B, isoform CRA_b [Rattus norvegicus]
GI:18017590 RefSeq NP_620260.2 312 lipid phosphate phosphohydrolase 3 [Rattus norvegicus]
GI:18017590 RefSeq XP_006987258.1 312 PREDICTED: lipid phosphate phosphohydrolase 3 [Peromyscus maniculatus bairdii]
GI:18017590 SwissProt P97544.1 312 RecName: Full=Lipid phosphate phosphohydrolase 3; AltName: Full=Differentially expressed in rat intestine 42; Short=Dri42; AltName: Full=PAP2-beta; AltName: Full=Phosphatidate phosphohydrolase type 2b; AltName: Full=Phosphatidic acid phosphatase 2b; Short=PAP-2b; Short=PAP2b [Rattus norvegicus]