Gene/Proteome Database (LMPD)

LMPD ID
LMP001499
Gene ID
16592
Species
Mus musculus (Mouse)
Gene Name
fatty acid binding protein 5, epidermal
Gene Symbol
Fabp5
Synonyms
E-FABP; Fabpe; Klbp; PA-FABP; mal1
Alternate Names
fatty acid-binding protein, epidermal; keratinocyte lipid-binding protein; epithelial fatty acid-binding protein; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
Chromosome
3
Map Location
3 A1-A3|3
Summary
The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. In humans this gene has been associated with psoriasis and type 2 diabetes. In mouse deficiency of this gene in combination with a deficiency in Fabp4 confers protection against atherosclerosis, diet-induced obesity, insulin resistance and experimental autoimmune encephalomyelitis (the mouse model for multiple sclerosis). Alternative splicing results in multiple transcript variants that encode different protein isoforms. The mouse genome contains many pseudogenes similar to this locus. [provided by RefSeq, Jan 2013]
Orthologs
View orthologs and multiple alignments for Fabp5

Proteins

fatty acid-binding protein, epidermal isoform 1
Refseq ID NP_034764
Protein GI 6754450
UniProt ID Q05816
mRNA ID NM_010634
Length 135
RefSeq Status REVIEWED
MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ

Gene Information

Entrez Gene ID
16592
Gene Name
fatty acid binding protein 5, epidermal
Gene Symbol
Fabp5
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005504 IEA:Ensembl F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0006006 IMP:MGI P glucose metabolic process
GO:0015758 IMP:MGI P glucose transport
GO:0006629 IMP:MGI P lipid metabolic process
GO:0006656 IGI:MGI P phosphatidylcholine biosynthetic process
GO:0009611 IEA:Ensembl P response to wounding

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mmu03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 5, epidermal
Protein Entry
FABP5_MOUSE
UniProt ID
Q05816
Species
Mouse

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function High specificity for fatty acids. Highest affinity for C18 chain length (By similarity). {ECO:0000250}.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Tissue Specificity Most abundant in keratinocytes and also in stratified epithelia of epidermis and tongue. Relatively high levels found in adipose and mammary tissues and small amounts found in heart, brain, liver, spleen, muscle and lung.

Identical and Related Proteins

Unique RefSeq proteins for LMP001499 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6754450 RefSeq NP_034764 135 fatty acid-binding protein, epidermal isoform 1

Identical Sequences to LMP001499 proteins

Reference Database Accession Length Protein Name
GI:6754450 DBBJ BAB25890.1 135 unnamed protein product [Mus musculus]
GI:6754450 DBBJ BAB27692.1 135 unnamed protein product [Mus musculus]
GI:6754450 DBBJ BAE39479.1 135 unnamed protein product [Mus musculus]
GI:6754450 GenBank AAI00544.1 135 Fatty acid binding protein 5, epidermal [Mus musculus]
GI:6754450 GenBank ABJ17547.1 135 Sequence 1 from patent US 7056662
GI:6754450 GenBank EDL05177.1 135 mCG1638 [Mus musculus]

Related Sequences to LMP001499 proteins

Reference Database Accession Length Protein Name
GI:6754450 PDB 4AZN 155 Chain A, Murine Epidermal Fatty Acid-binding Protein (fabp5), Apo Form, Poly-his Tag-mediated Crystal Packing
GI:6754450 PDB 4AZN 155 Chain B, Murine Epidermal Fatty Acid-binding Protein (fabp5), Apo Form, Poly-his Tag-mediated Crystal Packing
GI:6754450 PDB 4AZO 138 Chain A, Murine Epidermal Fatty Acid-binding Protein (fabp5), Apo Form, Poly-his Tag Removed
GI:6754450 PDB 4AZP 138 Chain A, Murine Epidermal Fatty Acid-binding Protein (fabp5) In Complex With The Endocannabinoid Anandamide
GI:6754450 PDB 4AZQ 138 Chain A, Murine Epidermal Fatty Acid-binding Protein (fabp5) In Complex With The Endocannabinoid 2-arachidonoylglycerol
GI:6754450 RefSeq NP_001259026.1 134 fatty acid-binding protein, epidermal isoform 2 [Mus musculus]