Gene/Proteome Database (LMPD)

LMPD ID
LMP001507
Gene ID
230379
Species
Mus musculus (Mouse)
Gene Name
alkaline ceramidase 2
Gene Symbol
Acer2
Synonyms
2410116I05Rik; Asah3l; CRG-L1; maCER2
Alternate Names
alkaline ceramidase 2; alkCDase 2; alkaline CDase 2; ceramide hydrolase; cancer-related gene liver 1 protein; cancer related gene-liver 1 (CRG-L1)
Chromosome
4
Map Location
4 C4|4
EC Number
3.5.1.23

Proteins

alkaline ceramidase 2 isoform 1
Refseq ID NP_647467
Protein GI 21314858
UniProt ID Q8VD53
mRNA ID NM_139306
Length 275
RefSeq Status VALIDATED
MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRNDRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPEQGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT
alkaline ceramidase 2 isoform 2
Refseq ID NP_001277470
Protein GI 594542520
UniProt ID Q8VD53
mRNA ID NM_001290541
Length 229
RefSeq Status VALIDATED
MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRNDRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWHILICLASYLGCVCFAYFDAASEIPEQGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT
alkaline ceramidase 2 isoform 3
Refseq ID NP_001277472
Protein GI 594542513
UniProt ID Q8VD53
mRNA ID NM_001290543
Length 219
RefSeq Status VALIDATED
MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVGIGSVYFHATLSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRNDRGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKRCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVWSADRG

Gene Information

Entrez Gene ID
230379
Gene Name
alkaline ceramidase 2
Gene Symbol
Acer2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:Ensembl C integral component of Golgi membrane
GO:0071633 IEA:Ensembl F dihydroceramidase activity
GO:0006919 IEA:Ensembl P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0035690 IEA:Ensembl P cellular response to drug
GO:0006672 IEA:InterPro P ceramide metabolic process
GO:0033629 IEA:Ensembl P negative regulation of cell adhesion mediated by integrin
GO:0001953 IEA:Ensembl P negative regulation of cell-matrix adhesion
GO:0090285 IEA:Ensembl P negative regulation of protein glycosylation in Golgi
GO:0010942 IEA:Ensembl P positive regulation of cell death
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0046512 IEA:Ensembl P sphingosine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00600 Sphingolipid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-11470 sphingosine and sphingosine-1-phosphate metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893777 Sphingolipid de novo biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008901 Ceramidase

UniProt Annotations

Entry Information

Gene Name
alkaline ceramidase 2
Protein Entry
ACER2_MOUSE
UniProt ID
Q8VD53
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8VD53-1; Sequence=Displayed; Name=2; IsoId=Q8VD53-2; Sequence=VSP_020036; Note=No experimental confirmation available.;
Catalytic Activity N-acylsphingosine + H(2)O = a carboxylate + sphingosine.
Enzyme Regulation Specifically activated by lumenal, but not cytosolic Ca(2+). {ECO:0000250}.
Function Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. Unsaturated long-chain ceramides are the best substrates, saturated long-chain ceramides and unsaturated very long-chain ceramides are good substrates, whereas saturated very long-chain ceramides and short-chain ceramides were poor substrates. Inhibits the maturation of protein glycosylation in the Golgi complex, including that of integrin beta-1 (ITGB1) and of LAMP1, by increasing the levels of sphingosine. Inhibits cell adhesion by reducing the level of ITGB1 in the cell surface. May have a role in cell proliferation and apoptosis that seems to depend on the balance between sphingosine and sphingosine-1- phosphate. {ECO:0000250}.
Miscellaneous Up-regulated in hepatocellular carcinomas.
Sequence Caution Sequence=BAC39416.1; Type=Miscellaneous discrepancy; Note=Chimera.; Evidence={ECO:0000305};
Similarity Belongs to the alkaline ceramidase family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001507 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21314858 RefSeq NP_647467 275 alkaline ceramidase 2 isoform 1
594542520 RefSeq NP_001277470 229 alkaline ceramidase 2 isoform 2
594542513 RefSeq NP_001277472 219 alkaline ceramidase 2 isoform 3

Identical Sequences to LMP001507 proteins

Reference Database Accession Length Protein Name
GI:594542513 DBBJ BAC39416.1 219 unnamed protein product [Mus musculus]
GI:21314858 GenBank AAL40408.1 275 cancer related gene-liver 1 [Mus musculus]
GI:21314858 GenBank AAQ85131.1 275 alkaline ceramidase 2 [Mus musculus]
GI:594542520 GenBank AAH59819.1 229 Acer2 protein [Mus musculus]
GI:594542513 GenBank EDL30987.1 219 N-acylsphingosine amidohydrolase 3-like, isoform CRA_a [Mus musculus]
GI:594542520 GenBank EDL30988.1 229 N-acylsphingosine amidohydrolase 3-like, isoform CRA_b [Mus musculus]
GI:21314858 GenBank EDL30989.1 275 N-acylsphingosine amidohydrolase 3-like, isoform CRA_c [Mus musculus]
GI:21314858 GenBank ABT11108.1 275 Sequence 2 from patent US 7220844
GI:21314858 SwissProt Q8VD53.1 275 RecName: Full=Alkaline ceramidase 2; Short=AlkCDase 2; Short=Alkaline CDase 2; Short=maCER2; AltName: Full=Acylsphingosine deacylase 3-like; AltName: Full=Cancer-related gene liver 1 protein; Short=CRG-L1; AltName: Full=N-acylsphingosine amidohydrolase 3-like [Mus musculus]

Related Sequences to LMP001507 proteins

Reference Database Accession Length Protein Name
GI:594542513 GenBank AAL40408.1 275 cancer related gene-liver 1 [Mus musculus]
GI:594542513 GenBank AAQ85131.1 275 alkaline ceramidase 2 [Mus musculus]
GI:594542513 GenBank EDL30989.1 275 N-acylsphingosine amidohydrolase 3-like, isoform CRA_c [Mus musculus]
GI:21314858 GenBank EDL76006.1 275 N-acylsphingosine amidohydrolase 3-like (predicted), isoform CRA_a [Rattus norvegicus]
GI:594542520 GenBank EDL76007.1 229 N-acylsphingosine amidohydrolase 3-like (predicted), isoform CRA_b [Rattus norvegicus]
GI:594542513 GenBank ABT11108.1 275 Sequence 2 from patent US 7220844
GI:594542520 GenBank ERE81653.1 229 alkaline ceramidase 2-like protein [Cricetulus griseus]
GI:594542513 RefSeq NP_647467.1 275 alkaline ceramidase 2 isoform 1 [Mus musculus]
GI:21314858 RefSeq NP_001101413.1 275 alkaline ceramidase 2 [Rattus norvegicus]
GI:21314858 RefSeq XP_002708124.1 275 PREDICTED: alkaline ceramidase 2 isoform X2 [Oryctolagus cuniculus]
GI:21314858 RefSeq XP_003472260.1 275 PREDICTED: alkaline ceramidase 2 [Cavia porcellus]
GI:594542520 RefSeq XP_004581136.1 229 PREDICTED: alkaline ceramidase 2 [Ochotona princeps]
GI:594542520 RefSeq XP_005074334.1 229 PREDICTED: alkaline ceramidase 2 [Mesocricetus auratus]
GI:21314858 RefSeq XP_006238425.1 275 PREDICTED: alkaline ceramidase 2 isoform X1 [Rattus norvegicus]
GI:21314858 RefSeq XP_006976034.1 275 PREDICTED: alkaline ceramidase 2 [Peromyscus maniculatus bairdii]
GI:594542520 RefSeq XP_007649672.1 229 PREDICTED: alkaline ceramidase 2 isoform X2 [Cricetulus griseus]
GI:594542520 RefSeq XP_008843754.1 229 PREDICTED: alkaline ceramidase 2 isoform X2 [Nannospalax galili]
GI:594542513 SwissProt Q8VD53.1 275 RecName: Full=Alkaline ceramidase 2; Short=AlkCDase 2; Short=Alkaline CDase 2; Short=maCER2; AltName: Full=Acylsphingosine deacylase 3-like; AltName: Full=Cancer-related gene liver 1 protein; Short=CRG-L1; AltName: Full=N-acylsphingosine amidohydrolase 3-like [Mus musculus]