Gene/Proteome Database (LMPD)

LMPD ID
LMP001531
Gene ID
134429
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
STARD4
Synonyms
-
Alternate Names
stAR-related lipid transfer protein 4; START domain-containing protein 4; START domain containing 4 sterol-regulated; START domain containing 4, sterol regulated
Chromosome
5
Map Location
5q22.1
Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Orthologs
View orthologs and multiple alignments for STARD4

Proteins

stAR-related lipid transfer protein 4
Refseq ID NP_631903
Protein GI 21040247
UniProt ID Q96DR4
mRNA ID NM_139164
Length 205
RefSeq Status PROVISIONAL
MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Gene Information

Entrez Gene ID
134429
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
STARD4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:UniProtKB-KW P lipid transport

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_111217 Metabolism
REACT_22258 Metabolism of lipids and lipoproteins
REACT_11057 Metabolism of steroid hormones and vitamin D
REACT_11038 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 4
Protein Entry
STAR4_HUMAN
UniProt ID
Q96DR4
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96DR4-1; Sequence=Displayed; Name=2; IsoId=Q96DR4-2; Sequence=VSP_057170; Note=No experimental confirmation available;
Function May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity).
Similarity Contains 1 START domain. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP001531 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21040247 RefSeq NP_631903 205 stAR-related lipid transfer protein 4

Identical Sequences to LMP001531 proteins

Reference Database Accession Length Protein Name
GI:21040247 GenBank ABE14076.1 205 Sequence 1642 from patent US 6979557
GI:21040247 GenBank EAW49031.1 205 START domain containing 4, sterol regulated, isoform CRA_f [Homo sapiens]
GI:21040247 GenBank AFO06891.1 205 Sequence 21 from patent US 8221999
GI:21040247 GenBank AHD70273.1 205 Sequence 2362 from patent US 8586006
GI:21040247 RefSeq XP_005271938.1 205 PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Homo sapiens]
GI:21040247 SwissProt Q96DR4.1 205 RecName: Full=StAR-related lipid transfer protein 4; AltName: Full=START domain-containing protein 4; Short=StARD4 [Homo sapiens]

Related Sequences to LMP001531 proteins

Reference Database Accession Length Protein Name
GI:21040247 DBBJ BAF83001.1 205 unnamed protein product [Homo sapiens]
GI:21040247 GenBank EHH26701.1 205 START domain-containing protein 4 [Macaca mulatta]
GI:21040247 GenBank EHH54441.1 205 START domain-containing protein 4 [Macaca fascicularis]
GI:21040247 RefSeq XP_517874.2 205 PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes]
GI:21040247 RefSeq XP_008950348.1 205 PREDICTED: stAR-related lipid transfer protein 4 [Pan paniscus]
GI:21040247 RefSeq XP_009447726.1 205 PREDICTED: stAR-related lipid transfer protein 4 isoform X1 [Pan troglodytes]