Gene/Proteome Database (LMPD)
LMPD ID
LMP001538
Gene ID
Species
Homo sapiens (Human)
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Synonyms
GSTS; GSTS1-1; PGD2; PGDS
Alternate Names
hematopoietic prostaglandin D synthase; GST class-sigma; prostaglandin-H2 D-isomerase; glutathione S-transferase sigma; glutathione-dependent PGD synthase; glutathione-dependent PGD synthetase; hematopoietic prostaglandin D2 synthase; glutathione-requiring prostaglandin D synthase
Chromosome
4
Map Location
4q22.3
EC Number
5.3.99.2
Summary
Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| hematopoietic prostaglandin D synthase | |
|---|---|
| Refseq ID | NP_055300 |
| Protein GI | 7657457 |
| UniProt ID | O60760 |
| mRNA ID | NM_014485 |
| Length | 199 |
| RefSeq Status | REVIEWED |
| MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL | |
Gene Information
Entrez Gene ID
Gene Name
hematopoietic prostaglandin D synthase
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | TAS:ProtInc | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005509 | IDA:UniProtKB | F | calcium ion binding |
| GO:0004364 | IEA:UniProtKB-EC | F | glutathione transferase activity |
| GO:0000287 | IDA:UniProtKB | F | magnesium ion binding |
| GO:0004667 | IDA:UniProtKB | F | prostaglandin-D synthase activity |
| GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
| GO:0019369 | TAS:Reactome | P | arachidonic acid metabolic process |
| GO:0019371 | TAS:Reactome | P | cyclooxygenase pathway |
| GO:1901687 | TAS:Reactome | P | glutathione derivative biosynthetic process |
| GO:0007626 | TAS:ProtInc | P | locomotory behavior |
| GO:0006693 | IDA:UniProtKB | P | prostaglandin metabolic process |
| GO:0007165 | NAS:ProtInc | P | signal transduction |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00590 | Arachidonic acid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_147851 | Arachidonic acid metabolism |
| REACT_150149 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hematopoietic prostaglandin D synthase
Protein Entry
HPGDS_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=8 mM for glutathione for the glutathione-conjugating activity {ECO |
| Catalytic Activity | (5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy- 11-oxoprosta-5,13-dienoate. |
| Catalytic Activity | RX + glutathione = HX + R-S-glutathione. |
| Cofactor | Name=glutathione; Xref=ChEBI |
| Developmental Stage | Highest levels in immature megakaryocytic cells. Disappears after final differentiation to platelets. |
| Enzyme Regulation | Prostaglandin PGD2 synthesis is stimulated by calcium and magnesium ions. One calcium or magnesium ion is bound between the subunits of the homodimer. The interactions with the protein are for the most part mediated via water molecules. Magnesium increases the affinity for glutathione, while calcium has no effect on the affinity for glutathione. |
| Function | Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide. {ECO |
| Induction | By 12-O-tetradecanoylphorbol-13-acetate (TPA). |
| Similarity | Belongs to the GST superfamily. Sigma family. |
| Similarity | Contains 1 GST C-terminal domain. |
| Similarity | Contains 1 GST N-terminal domain. |
| Subcellular Location | Cytoplasm . |
| Subunit | Homodimer. {ECO |
| Tissue Specificity | Expressed in a number of megakaryocytic cell lines but not in platelets. Highly expressed in adipose tissue, macrophages and placenta. Also expressed at lower levels in lung, heart, lymph nodes, appendix, bone marrow and fetal liver. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001538 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7657457 | RefSeq | NP_055300 | 199 | hematopoietic prostaglandin D synthase |
Identical Sequences to LMP001538 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657457 | DBBJ | BAJ20840.1 | 199 | hematopoietic prostaglandin D synthase, partial [synthetic construct] |
| GI:7657457 | GenBank | AEF64127.1 | 199 | Sequence 122 from patent US 7932032 |
| GI:7657457 | GenBank | AFN90229.1 | 199 | Sequence 122 from patent US 8198025 |
| GI:7657457 | GenBank | AIC51217.1 | 199 | HPGDS, partial [synthetic construct] |
| GI:7657457 | PDB | 2VD1 | 199 | Chain C, Complex Structure Of Prostaglandin D2 Synthase At 2.25a. |
| GI:7657457 | PDB | 2VD1 | 199 | Chain D, Complex Structure Of Prostaglandin D2 Synthase At 2.25a. |
Related Sequences to LMP001538 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657457 | GenBank | AAX37080.1 | 200 | prostaglandin D2 synthase, partial [synthetic construct] |
| GI:7657457 | PDB | 3EE2 | 199 | Chain A, Structure Of Human Prostaglandin D-Synthase (Hgsts1-1) In Complex With Nocodazole |
| GI:7657457 | PDB | 3KXO | 202 | Chain A, An Orally Active Inhibitor Bound At The Active Site Of Hpgds |
| GI:7657457 | PDB | 3KXO | 202 | Chain B, An Orally Active Inhibitor Bound At The Active Site Of Hpgds |
| GI:7657457 | PDB | 4EC0 | 200 | Chain A, Crystal Structure Of Hh-Pgds With Water Displacing Inhibitor |
| GI:7657457 | PDB | 4EC0 | 200 | Chain B, Crystal Structure Of Hh-Pgds With Water Displacing Inhibitor |