Gene/Proteome Database (LMPD)
LMPD ID
LMP001570
Gene ID
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-IV
Gene Symbol
Synonyms
APO-CIV; APOC-IV
Alternate Names
apolipoprotein C-IV; apolipoprotein C4
Chromosome
19
Map Location
19q13.2
Summary
This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene. [provided by RefSeq, Mar 2011]
Orthologs
Proteins
apolipoprotein C-IV precursor | |
---|---|
Refseq ID | NP_001637 |
Protein GI | 4502161 |
UniProt ID | P55056 |
mRNA ID | NM_001646 |
Length | 127 |
RefSeq Status | REVIEWED |
MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG | |
sig_peptide: 1..26 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P55056.1) calculated_mol_wt: 2756 peptide sequence: MSLLRNRLQALPALCLCVLVLACIGA mat_peptide: 27..127 product: Apolipoprotein C-IV experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P55056.1) calculated_mol_wt: 11816 peptide sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0034364 | IDA:BHF-UCL | C | high-density lipoprotein particle |
GO:0034361 | IDA:BHF-UCL | C | very-low-density lipoprotein particle |
GO:0005319 | TAS:ProtInc | F | lipid transporter activity |
GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
GO:0010890 | IMP:BHF-UCL | P | positive regulation of sequestering of triglyceride |
GO:0070328 | IMP:BHF-UCL | P | triglyceride homeostasis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR028120 | Apolipoprotein C-IV |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | May participate in lipoprotein metabolism. |
Similarity | Belongs to the apolipoprotein C4 family. |
Subcellular Location | Secreted. |
Tissue Specificity | Expressed by the liver and secreted in plasma. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001570 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4502161 | RefSeq | NP_001637 | 127 | apolipoprotein C-IV precursor |
Identical Sequences to LMP001570 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4502161 | GenBank | ADC27389.1 | 127 | Sequence 79 from patent US 7651840 |
GI:4502161 | GenBank | ADC27390.1 | 127 | Sequence 80 from patent US 7651840 |
GI:4502161 | GenBank | AEK13832.1 | 127 | Sequence 1 from patent US 7972802 |
GI:4502161 | GenBank | AGM56985.1 | 127 | Sequence 1 from patent US 8420337 |
GI:4502161 | GenBank | AHD72432.1 | 127 | Sequence 9500 from patent US 8586006 |
GI:4502161 | GenBank | AIC48279.1 | 127 | APOC4, partial [synthetic construct] |
Related Sequences to LMP001570 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4502161 | EMBL | CAE93838.1 | 127 | unnamed protein product [Homo sapiens] |
GI:4502161 | GenBank | AAQ91812.1 | 127 | apolipoprotein C-IV [Homo sapiens] |
GI:4502161 | GenBank | ABA85921.1 | 127 | Sequence 7853 from patent US 6783961 |
GI:4502161 | GenBank | ABJ47114.1 | 127 | Sequence 7853 from patent US 7115416 |
GI:4502161 | GenBank | ABQ40075.1 | 127 | apolipoprotein C-IV [Homo sapiens] |
GI:4502161 | RefSeq | XP_004060989.1 | 127 | PREDICTED: apolipoprotein C-IV isoform 2 [Gorilla gorilla gorilla] |