Gene/Proteome Database (LMPD)

LMPD ID
LMP001570
Gene ID
Species
Homo sapiens (Human)
Gene Name
apolipoprotein C-IV
Gene Symbol
Synonyms
APO-CIV; APOC-IV
Alternate Names
apolipoprotein C-IV; apolipoprotein C4
Chromosome
19
Map Location
19q13.2
Summary
This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene. [provided by RefSeq, Mar 2011]
Orthologs

Proteins

apolipoprotein C-IV precursor
Refseq ID NP_001637
Protein GI 4502161
UniProt ID P55056
mRNA ID NM_001646
Length 127
RefSeq Status REVIEWED
MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
sig_peptide: 1..26 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P55056.1) calculated_mol_wt: 2756 peptide sequence: MSLLRNRLQALPALCLCVLVLACIGA mat_peptide: 27..127 product: Apolipoprotein C-IV experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P55056.1) calculated_mol_wt: 11816 peptide sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein C-IV
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0034364 IDA:BHF-UCL C high-density lipoprotein particle
GO:0034361 IDA:BHF-UCL C very-low-density lipoprotein particle
GO:0005319 TAS:ProtInc F lipid transporter activity
GO:0006629 TAS:ProtInc P lipid metabolic process
GO:0010890 IMP:BHF-UCL P positive regulation of sequestering of triglyceride
GO:0070328 IMP:BHF-UCL P triglyceride homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR028120 Apolipoprotein C-IV

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-IV
Protein Entry
APOC4_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function May participate in lipoprotein metabolism.
Similarity Belongs to the apolipoprotein C4 family.
Subcellular Location Secreted.
Tissue Specificity Expressed by the liver and secreted in plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP001570 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4502161 RefSeq NP_001637 127 apolipoprotein C-IV precursor

Identical Sequences to LMP001570 proteins

Reference Database Accession Length Protein Name
GI:4502161 GenBank ADC27389.1 127 Sequence 79 from patent US 7651840
GI:4502161 GenBank ADC27390.1 127 Sequence 80 from patent US 7651840
GI:4502161 GenBank AEK13832.1 127 Sequence 1 from patent US 7972802
GI:4502161 GenBank AGM56985.1 127 Sequence 1 from patent US 8420337
GI:4502161 GenBank AHD72432.1 127 Sequence 9500 from patent US 8586006
GI:4502161 GenBank AIC48279.1 127 APOC4, partial [synthetic construct]

Related Sequences to LMP001570 proteins

Reference Database Accession Length Protein Name
GI:4502161 EMBL CAE93838.1 127 unnamed protein product [Homo sapiens]
GI:4502161 GenBank AAQ91812.1 127 apolipoprotein C-IV [Homo sapiens]
GI:4502161 GenBank ABA85921.1 127 Sequence 7853 from patent US 6783961
GI:4502161 GenBank ABJ47114.1 127 Sequence 7853 from patent US 7115416
GI:4502161 GenBank ABQ40075.1 127 apolipoprotein C-IV [Homo sapiens]
GI:4502161 RefSeq XP_004060989.1 127 PREDICTED: apolipoprotein C-IV isoform 2 [Gorilla gorilla gorilla]