Gene/Proteome Database (LMPD)

LMPD ID
LMP001580
Gene ID
8612
Species
Homo sapiens (Human)
Gene Name
phosphatidic acid phosphatase type 2C
Gene Symbol
PPAP2C
Synonyms
LPP2; PAP-2c; PAP2-g
Alternate Names
lipid phosphate phosphohydrolase 2; PAP2c; PAP2-gamma; phosphatidic acid phosphatase 2c; phosphatidate phosphohydrolase type 2c; phosphatidic acid phosphohydrolase type 2c; type-2 phosphatidic acid phosphatase-gamma
Chromosome
19
Map Location
19p13
EC Number
3.1.3.4
Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is similar to phosphatidic acid phosphatase type 2A (PPAP2A) and type 2B (PPAP2B). All three proteins contain 6 transmembrane regions, and a consensus N-glycosylation site. This protein has been shown to possess membrane associated PAP activity. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PPAP2C

Proteins

lipid phosphate phosphohydrolase 2 isoform 1
Refseq ID NP_003703
Protein GI 4505977
UniProt ID O43688
mRNA ID NM_003712
Length 288
RefSeq Status REVIEWED
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
lipid phosphate phosphohydrolase 2 isoform 2
Refseq ID NP_803545
Protein GI 4505977
UniProt ID O43688
mRNA ID NM_177526
Length 288
RefSeq Status REVIEWED
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
lipid phosphate phosphohydrolase 2 isoform 3
Refseq ID NP_808211
Protein GI 4505977
UniProt ID O43688
mRNA ID NM_177543
Length 288
RefSeq Status REVIEWED
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Gene Information

Entrez Gene ID
8612
Gene Name
phosphatidic acid phosphatase type 2C
Gene Symbol
PPAP2C
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 TAS:ProtInc C membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0008195 IEA:UniProtKB-EC F phosphatidate phosphatase activity
GO:0004721 TAS:ProtInc F phosphoprotein phosphatase activity
GO:0016311 TAS:GOC P dephosphorylation
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0030148 TAS:Reactome P sphingolipid biosynthetic process
GO:0006665 TAS:Reactome P sphingolipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa04666 Fc gamma R-mediated phagocytosis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_115810 Sphingolipid de novo biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR028674 Lipid phosphate phosphohydrolase 2
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase type 2C
Protein Entry
LPP2_HUMAN
UniProt ID
O43688
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O43688-1; Sequence=Displayed; Name=2; IsoId=O43688-2; Sequence=VSP_037765; Note=No experimental confirmation available.; Name=3; IsoId=O43688-3; Sequence=VSP_047366; Note=Gene prediction based on EST data.;
Catalytic Activity A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate.
Enzyme Regulation Inhibited by sphingosine, zinc ions and propanolol.
Function Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is PA > C-1-P > LPA > S-1-P.
Similarity Belongs to the PA-phosphatase related phosphoesterase family.
Subcellular Location Membrane; Multi-pass membrane protein.
Subunit Homodimer.
Tissue Specificity Found mainly in brain, pancreas and placenta.

Identical and Related Proteins

Unique RefSeq proteins for LMP001580 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505977 RefSeq NP_003703 288 lipid phosphate phosphohydrolase 2 isoform 1
4505977 RefSeq NP_803545 288 lipid phosphate phosphohydrolase 2 isoform 2
4505977 RefSeq NP_808211 288 lipid phosphate phosphohydrolase 2 isoform 3

Identical Sequences to LMP001580 proteins

Reference Database Accession Length Protein Name
GI:4505977 GenBank AAC15968.1 288 type-2 phosphatidic acid phosphatase-gamma [Homo sapiens]
GI:4505977 GenBank AAC15968.1 288 type-2 phosphatidic acid phosphatase-gamma [Homo sapiens]
GI:4505977 GenBank AAC15968.1 288 type-2 phosphatidic acid phosphatase-gamma [Homo sapiens]
GI:4505977 GenBank AAH02806.1 288 Phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAH02806.1 288 Phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAH02806.1 288 Phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAP35667.1 288 phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAP35667.1 288 phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAP35667.1 288 phosphatidic acid phosphatase type 2C [Homo sapiens]
GI:4505977 GenBank AAX32478.1 288 phosphatidic acid phosphatase type 2C [synthetic construct]
GI:4505977 GenBank AAX32478.1 288 phosphatidic acid phosphatase type 2C [synthetic construct]
GI:4505977 GenBank AAX32478.1 288 phosphatidic acid phosphatase type 2C [synthetic construct]
GI:4505977 GenBank AIC50159.1 288 PPAP2C, partial [synthetic construct]
GI:4505977 GenBank AIC50159.1 288 PPAP2C, partial [synthetic construct]
GI:4505977 GenBank AIC50159.1 288 PPAP2C, partial [synthetic construct]
GI:4505977 SwissProt O43688.1 288 RecName: Full=Lipid phosphate phosphohydrolase 2; AltName: Full=PAP2-gamma; Short=PAP2-G; AltName: Full=Phosphatidate phosphohydrolase type 2c; AltName: Full=Phosphatidic acid phosphatase 2c; Short=PAP-2c; Short=PAP2c [Homo sapiens]
GI:4505977 SwissProt O43688.1 288 RecName: Full=Lipid phosphate phosphohydrolase 2; AltName: Full=PAP2-gamma; Short=PAP2-G; AltName: Full=Phosphatidate phosphohydrolase type 2c; AltName: Full=Phosphatidic acid phosphatase 2c; Short=PAP-2c; Short=PAP2c [Homo sapiens]
GI:4505977 SwissProt O43688.1 288 RecName: Full=Lipid phosphate phosphohydrolase 2; AltName: Full=PAP2-gamma; Short=PAP2-G; AltName: Full=Phosphatidate phosphohydrolase type 2c; AltName: Full=Phosphatidic acid phosphatase 2c; Short=PAP-2c; Short=PAP2c [Homo sapiens]

Related Sequences to LMP001580 proteins

Reference Database Accession Length Protein Name
GI:4505977 GenBank AAP36491.1 289 Homo sapiens phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank AAP36491.1 289 Homo sapiens phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank AAP36491.1 289 Homo sapiens phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank AAX29060.1 289 phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank AAX29060.1 289 phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank AAX29060.1 289 phosphatidic acid phosphatase type 2C, partial [synthetic construct]
GI:4505977 GenBank EAW61209.1 288 phosphatidic acid phosphatase type 2C, isoform CRA_c [Homo sapiens]
GI:4505977 GenBank EAW61209.1 288 phosphatidic acid phosphatase type 2C, isoform CRA_c [Homo sapiens]
GI:4505977 GenBank EAW61209.1 288 phosphatidic acid phosphatase type 2C, isoform CRA_c [Homo sapiens]
GI:4505977 GenBank JAA24246.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 GenBank JAA24246.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 GenBank JAA24246.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 GenBank JAA37804.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 GenBank JAA37804.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 GenBank JAA37804.1 288 phosphatidic acid phosphatase type 2C [Pan troglodytes]
GI:4505977 RefSeq XP_005587366.1 287 PREDICTED: lipid phosphate phosphohydrolase 2 isoform X1 [Macaca fascicularis]
GI:4505977 RefSeq XP_005587366.1 287 PREDICTED: lipid phosphate phosphohydrolase 2 isoform X1 [Macaca fascicularis]
GI:4505977 RefSeq XP_005587366.1 287 PREDICTED: lipid phosphate phosphohydrolase 2 isoform X1 [Macaca fascicularis]