Gene/Proteome Database (LMPD)
LMPD ID
LMP001584
Gene ID
Species
Mus musculus (Mouse)
Gene Name
monoacylglycerol O-acyltransferase 1
Gene Symbol
Synonyms
0610030A14Rik; 1110064N14Rik; Dgat2l; Dgat2l1; MGAT1; mDC2
Alternate Names
2-acylglycerol O-acyltransferase 1; diacylglycerol O-acyltransferase 2-like 1; acyl CoA:monoacylglycerol acyltransferase 1; acyl-CoA:monoacylglycerol acyltransferase 1; diacylglycerol acyltransferase 2-like protein 1
Chromosome
1
Map Location
1 C4|1
EC Number
2.3.1.22
Proteins
2-acylglycerol O-acyltransferase 1 | |
---|---|
Refseq ID | NP_080989 |
Protein GI | 229577408 |
UniProt ID | Q91ZV4 |
mRNA ID | NM_026713 |
Length | 335 |
RefSeq Status | VALIDATED |
MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK |
Gene Information
Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:MGI | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | IDA:MGI | C | membrane |
GO:0003846 | IDA:MGI | F | 2-acylglycerol O-acyltransferase activity |
GO:0004144 | IDA:MGI | F | diacylglycerol O-acyltransferase activity |
GO:0006651 | IDA:MGI | P | diacylglycerol biosynthetic process |
GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
GO:0019432 | IEA:UniProtKB-UniPathway | P | triglyceride biosynthetic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
monoacylglycerol O-acyltransferase 1
Protein Entry
MOGT1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol. {ECO:0000269|PubMed:12077311}. |
Function | Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. {ECO:0000269|PubMed:12077311}. |
Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
Similarity | Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305|PubMed:12077311}; Multi-pass membrane protein {ECO:0000305|PubMed:12077311}. |
Tissue Specificity | Expressed at high level in kidney and stomach. Expressed at lower level in brown and white adipose tissue, uterus and liver. Not detected in small intestine. {ECO:0000269|PubMed:12077311}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001584 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
229577408 | RefSeq | NP_080989 | 335 | 2-acylglycerol O-acyltransferase 1 |
Identical Sequences to LMP001584 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229577408 | RefSeq | XP_006496589.1 | 335 | PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X1 [Mus musculus] |
GI:229577408 | RefSeq | XP_006496590.1 | 335 | PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X2 [Mus musculus] |
GI:229577408 | SwissProt | Q91ZV4.2 | 335 | RecName: Full=2-acylglycerol O-acyltransferase 1; AltName: Full=Acyl-CoA:monoacylglycerol acyltransferase 1; Short=MGAT1; AltName: Full=Diacylglycerol acyltransferase 2-like protein 1; AltName: Full=Monoacylglycerol O-acyltransferase 1 [Mus musculus] |
Related Sequences to LMP001584 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:229577408 | GenBank | JAB09167.1 | 335 | 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus] |
GI:229577408 | GenBank | JAB34382.1 | 335 | 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus] |
GI:229577408 | RefSeq | XP_002749878.1 | 335 | PREDICTED: 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus] |
GI:229577408 | RefSeq | XP_003925530.1 | 335 | PREDICTED: 2-acylglycerol O-acyltransferase 1 [Saimiri boliviensis boliviensis] |
GI:229577408 | RefSeq | XP_006496591.1 | 300 | PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X3 [Mus musculus] |
GI:229577408 | RefSeq | XP_006497368.1 | 297 | PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X3 [Mus musculus] |