Gene/Proteome Database (LMPD)

LMPD ID
LMP001584
Gene ID
Species
Mus musculus (Mouse)
Gene Name
monoacylglycerol O-acyltransferase 1
Gene Symbol
Synonyms
0610030A14Rik; 1110064N14Rik; Dgat2l; Dgat2l1; MGAT1; mDC2
Alternate Names
2-acylglycerol O-acyltransferase 1; diacylglycerol O-acyltransferase 2-like 1; acyl CoA:monoacylglycerol acyltransferase 1; acyl-CoA:monoacylglycerol acyltransferase 1; diacylglycerol acyltransferase 2-like protein 1
Chromosome
1
Map Location
1 C4|1
EC Number
2.3.1.22

Proteins

2-acylglycerol O-acyltransferase 1
Refseq ID NP_080989
Protein GI 229577408
UniProt ID Q91ZV4
mRNA ID NM_026713
Length 335
RefSeq Status VALIDATED
MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK

Gene Information

Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:MGI C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:MGI C membrane
GO:0003846 IDA:MGI F 2-acylglycerol O-acyltransferase activity
GO:0004144 IDA:MGI F diacylglycerol O-acyltransferase activity
GO:0006651 IDA:MGI P diacylglycerol biosynthetic process
GO:0006071 IEA:UniProtKB-KW P glycerol metabolic process
GO:0019432 IEA:UniProtKB-UniPathway P triglyceride biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR007130 Diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
monoacylglycerol O-acyltransferase 1
Protein Entry
MOGT1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol. {ECO:0000269|PubMed:12077311}.
Function Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. {ECO:0000269|PubMed:12077311}.
Pathway Glycerolipid metabolism; triacylglycerol biosynthesis.
Similarity Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305|PubMed:12077311}; Multi-pass membrane protein {ECO:0000305|PubMed:12077311}.
Tissue Specificity Expressed at high level in kidney and stomach. Expressed at lower level in brown and white adipose tissue, uterus and liver. Not detected in small intestine. {ECO:0000269|PubMed:12077311}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001584 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
229577408 RefSeq NP_080989 335 2-acylglycerol O-acyltransferase 1

Identical Sequences to LMP001584 proteins

Reference Database Accession Length Protein Name
GI:229577408 RefSeq XP_006496589.1 335 PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X1 [Mus musculus]
GI:229577408 RefSeq XP_006496590.1 335 PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X2 [Mus musculus]
GI:229577408 SwissProt Q91ZV4.2 335 RecName: Full=2-acylglycerol O-acyltransferase 1; AltName: Full=Acyl-CoA:monoacylglycerol acyltransferase 1; Short=MGAT1; AltName: Full=Diacylglycerol acyltransferase 2-like protein 1; AltName: Full=Monoacylglycerol O-acyltransferase 1 [Mus musculus]

Related Sequences to LMP001584 proteins

Reference Database Accession Length Protein Name
GI:229577408 GenBank JAB09167.1 335 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus]
GI:229577408 GenBank JAB34382.1 335 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus]
GI:229577408 RefSeq XP_002749878.1 335 PREDICTED: 2-acylglycerol O-acyltransferase 1 [Callithrix jacchus]
GI:229577408 RefSeq XP_003925530.1 335 PREDICTED: 2-acylglycerol O-acyltransferase 1 [Saimiri boliviensis boliviensis]
GI:229577408 RefSeq XP_006496591.1 300 PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X3 [Mus musculus]
GI:229577408 RefSeq XP_006497368.1 297 PREDICTED: 2-acylglycerol O-acyltransferase 1 isoform X3 [Mus musculus]