Gene/Proteome Database (LMPD)
LMPD ID
LMP001605
Gene ID
Species
Homo sapiens (Human)
Gene Name
cholesterol 25-hydroxylase
Gene Symbol
Synonyms
C25H
Alternate Names
cholesterol 25-hydroxylase; h25OH; cholesterol 25-monooxygenase
Chromosome
10
Map Location
10q23
EC Number
1.14.99.38
Summary
This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| cholesterol 25-hydroxylase | |
|---|---|
| Refseq ID | NP_003947 |
| Protein GI | 4502499 |
| UniProt ID | O95992 |
| mRNA ID | NM_003956 |
| Length | 272 |
| RefSeq Status | REVIEWED |
| MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0001567 | IEA:UniProtKB-EC | F | cholesterol 25-hydroxylase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0008395 | TAS:Reactome | F | steroid hydroxylase activity |
| GO:0006699 | TAS:Reactome | P | bile acid biosynthetic process |
| GO:0008206 | TAS:Reactome | P | bile acid metabolic process |
| GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00120 | Primary bile acid biosynthesis |
| ko00120 | Primary bile acid biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11040 | Bile acid and bile salt metabolism |
| REACT_11054 | Synthesis of bile acids and bile salts |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Cholesterol + AH(2) + O(2) = 25- hydroxycholesterol + A + H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI |
| Function | Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. In testis, production of 25- hydroxycholesterol by macrophages may play a role in Leydig cell differentiation. |
| Ptm | N-glycosylated. |
| Similarity | Belongs to the sterol desaturase family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001605 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502499 | RefSeq | NP_003947 | 272 | cholesterol 25-hydroxylase |
Identical Sequences to LMP001605 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502499 | DBBJ | BAG37380.1 | 272 | unnamed protein product [Homo sapiens] |
| GI:4502499 | EMBL | CAR81282.1 | 272 | unnamed protein product [Homo sapiens] |
| GI:4502499 | EMBL | CBX84760.1 | 272 | unnamed protein product [Homo sapiens] |
| GI:4502499 | GenBank | AEL91006.1 | 272 | Sequence 2 from patent US 7981598 |
| GI:4502499 | GenBank | AIC50257.1 | 272 | CH25H, partial [synthetic construct] |
| GI:4502499 | GenBank | AIC55509.1 | 272 | CH25H, partial [synthetic construct] |
Related Sequences to LMP001605 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502499 | GenBank | ACM82469.1 | 275 | Sequence 7967 from patent US 6812339 |
| GI:4502499 | GenBank | JAA00727.1 | 272 | cholesterol 25-hydroxylase [Pan troglodytes] |
| GI:4502499 | GenBank | JAA25465.1 | 272 | cholesterol 25-hydroxylase [Pan troglodytes] |
| GI:4502499 | RefSeq | XP_507901.2 | 272 | PREDICTED: cholesterol 25-hydroxylase [Pan troglodytes] |
| GI:4502499 | RefSeq | XP_003825384.1 | 272 | PREDICTED: cholesterol 25-hydroxylase [Pan paniscus] |
| GI:4502499 | RefSeq | XP_004049806.1 | 272 | PREDICTED: cholesterol 25-hydroxylase [Gorilla gorilla gorilla] |