Gene/Proteome Database (LMPD)

LMPD ID
LMP001631
Gene ID
284904
Species
Homo sapiens (Human)
Gene Name
SEC14-like 4 (S. cerevisiae)
Gene Symbol
SEC14L4
Synonyms
TAP3
Chromosome
22
Map Location
22q12.2
Summary
The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
Orthologs
View orthologs and multiple alignments for SEC14L4

Proteins

SEC14-like protein 4 isoform a
Refseq ID NP_777637
Protein GI 28376621
UniProt ID Q9UDX3
mRNA ID NM_174977
Length 406
RefSeq Status REVIEWED
MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ
SEC14-like protein 4 isoform b
Refseq ID NP_001154840
Protein GI 238624167
UniProt ID Q9UDX3
mRNA ID NM_001161368
Length 360
RefSeq Status REVIEWED
MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGV

Gene Information

Entrez Gene ID
284904
Gene Name
SEC14-like 4 (S. cerevisiae)
Gene Symbol
SEC14L4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:InterPro C integral component of membrane
GO:0005622 IEA:InterPro C intracellular
GO:0005215 IEA:InterPro F transporter activity

Domain Information

InterPro Annotations

Accession Description
IPR001251 CRAL-TRIO domain
IPR011074 CRAL/TRIO, N-terminal domain
IPR001071 Cellular retinaldehyde binding/alpha-tocopherol transport
IPR009038 GOLD

UniProt Annotations

Entry Information

Gene Name
SEC14-like 4 (S. cerevisiae)
Protein Entry
S14L4_HUMAN
UniProt ID
Q9UDX3
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP001631 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
28376621 RefSeq NP_777637 406 SEC14-like protein 4 isoform a
238624167 RefSeq NP_001154840 360 SEC14-like protein 4 isoform b

Identical Sequences to LMP001631 proteins

Reference Database Accession Length Protein Name
GI:28376621 DBBJ BAG52719.1 406 unnamed protein product [Homo sapiens]
GI:28376621 GenBank EAW59897.1 406 SEC14-like 4 (S. cerevisiae), isoform CRA_c [Homo sapiens]
GI:238624167 GenBank AAI39913.1 360 SEC14L4 protein [Homo sapiens]
GI:28376621 GenBank AAI36359.1 406 SEC14-like 4 (S. cerevisiae) [Homo sapiens]
GI:28376621 GenBank AAI36360.1 406 SEC14-like 4 (S. cerevisiae) [Homo sapiens]
GI:28376621 GenBank AHE01601.1 406 Sequence 57737 from patent US 8586006
GI:28376621 SwissProt Q9UDX3.1 406 RecName: Full=SEC14-like protein 4; AltName: Full=Tocopherol-associated protein 3 [Homo sapiens]

Related Sequences to LMP001631 proteins

Reference Database Accession Length Protein Name
GI:238624167 DBBJ BAG52719.1 406 unnamed protein product [Homo sapiens]
GI:238624167 GenBank AAO21869.1 406 SEC14p-like protein TAP3 [Homo sapiens]
GI:238624167 GenBank EAW59897.1 406 SEC14-like 4 (S. cerevisiae), isoform CRA_c [Homo sapiens]
GI:238624167 GenBank AHE01601.1 406 Sequence 57737 from patent US 8586006
GI:238624167 gnl WUGSC 406 similar to 45 kDa secretory protein [Rattus norvegicus]; similar to CAA10644.1 (PID:g4164418) [Homo sapiens]
GI:28376621 PDB 4TLG 404 Chain A, Crystal Structure Of Sec14-like Protein 4 (sec14l4)
GI:28376621 PDB 4TLG 404 Chain B, Crystal Structure Of Sec14-like Protein 4 (sec14l4)
GI:238624167 RefSeq NP_777637.1 406 SEC14-like protein 4 isoform a [Homo sapiens]
GI:28376621 RefSeq XP_001136598.1 406 PREDICTED: SEC14-like protein 4 isoform X3 [Pan troglodytes]
GI:28376621 RefSeq XP_003812073.1 406 PREDICTED: SEC14-like protein 4 isoform X2 [Pan paniscus]
GI:28376621 RefSeq XP_005261640.1 407 PREDICTED: SEC14-like protein 4 isoform X1 [Homo sapiens]
GI:28376621 RefSeq XP_008962670.1 406 PREDICTED: SEC14-like protein 4 isoform X2 [Pan paniscus]